Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029561 (Oasl2)
Chromosomal location
Chr 5: 115347516 - 115362233 (+)
Description
2'-5' oligoadenylate synthetase-like 2 Gene [Source:MGI (curated);Acc:Oasl2-001]
RefSeq_dna
NM_011854 
RefSeq_peptide
NP_035984.2 
UniGene
Mm.228363 
MGI
MGI:1344390 
Uniprot/SWISSPROT
Q9Z2F2 
Uniprot/SPTREMBL
Q3UDH2 Q8K234 Q9D6S2 
Human Ortholog
not available
Omim not available
UniTrap UNI14098
Vector Insertion
Chr 5: 115356814 - 115360899
Public Clones CMHD-GT_386A1-3 (cmhd) CMHD-GT_115A7-3 (cmhd)
Private Clones OST173648 (lexicon) OST104262 (lexicon) OST14784 (lexicon)
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000031542
Sequence
CCAGTTTCTCCAAGGAGGGAGGGGCAGAGCGCTTTTCTTCTTTCCATGCAACTCTCCATCCCATTGTCTCCTCCAGAGAACGCTGCAGGAAGCTTCTCCC

ATCAGAGCTGAGCAGAAGCTCAGAGGATTTATCTAGAGGACAGGCTGGCCCAGCTGAAATGGACCCGTTCCCCGACCTGTATGCGACCCCTGGGGACAGT

CTAGACCACTTCCTGGAACACAGCCTTCAGCCCCAGAGGGACTGGAAAGAGGAAGGGCAGGATGCCTGGGAGAGAATCGAGAGGTTCTTTCGGGAACAGT

GCTTCCGTGATGAGCTGCTCCTGGACCAAGAAGTCAGGGTGATTAAGGTGGTGAAG GGAGGCTCCTCGGGAAAGGGGACAACGCTGAACCACAGATCTG

ACCAAGACATGATTCTGTTCTTAAGCTGCTTTTCCAGTTTCGAAGAGCAGGCGAGAAACCGGGAGGTCGTCATCAGCTTCATTAAGAAGAGGCTGATTCA

TTGTAGCAGAAGCCTGGCCTACAACATCATTGTCCTTACCCACAGAGAGGGCAAAAGGGCCCCTCGCTCCCTCACCCTAAAGGTTCAGTCCCGGAAGACT

GATGACATTATTTGGATGGATATCCTCCCAGCTTACGATGCTTTGG GACCTATTTCCAGAGACTCAAAACCAGCACCGGCAATCTACGAGACTCTGATA

AGAAGTAAGGGCTACCCTGGTGACTTCTCACCAAGCTTCACAGAGTTACAGAGACATTTTGTGAAAACTCGCCCAGTTAAACTGAAGAACCTCCTCCGGT

TGGTGAAGTTCTGGTACCTGCAG TGCCTGAGACGTAAATATGGAAGAGGTGCAGTGTTGCCCTCAAAATATGCTCTGGAGCTGCTGACCATCTACGCCT

GGGAGATGGGTACAGAGAGCAGTGATAGCTTCAATCTGGATGAAGGGTTCGTAGCCGTGATGGAGCTCCTCGTAAACTACCGCGACATCTGCATCTACTG

GACCAAGTACTACAATTTCCAAAACGAGGTCGTCAGGAACTTTCTGAAGAAACAGCTGAAGGGAGACCG GCCCATCATCCTAGACCCAGCTGACCCCAC

CAACAACCTGGGAAGAAGAAAGGGATGGGAACAGGTGGCTGCAGAAGCTGCTTTCTGCCTGCTGCAGGTCTGTTGCACGACTGTAGGCCCCAGCGAGCGC

TGGAATGTACAG - UNI14098 - CGAGCGAGGGATGTTCAGGTGAGAGTGAAACAAACGGGAACAGTGGATTGGACACTCTGGACAAACCCCTACAG

CCCCATCAGAAAGATGAAGGCAGAGATCAGGAGGGAAAAGAACTTTGGAGGGGAACTGCGCATCTCCTTCCAGGAGCCCGGAGGGGAGAGACAGCTGCTC

AGCAGCAGGAAGACCCTAGCAGATTATGGGATATTCTCTAAGGTGAACATTCAAGTGCTGGAGACCTTTCCTCCTGAGATCCTGGTCTTTGTGAAGTATC

CTGGTGGCCAGAGCAAGCCTTTCACCATCGACCCTGATGATACCATCTTAGATCTGAAAGAGAAGATAGAAGATGCTGGAGGCCCTTGTGCGGAGGATCA

GGTACTACTGTTGGATGATGAGGAGTTGGAAGATGATGAGAGCCTTAAAGAGCTTGAGATCAAAGACTGCGACACCATCATACTCATTAGGGTAATCGAC

TAGTCTGGCTGCTTGAGTCCGTGCCTAGAGTCTTACGCCTCCCTACCTCATCCCTAGACTCTGATGGGTTCTTTCTATAGCTTAAATATCAACATTCCCT

TCTCTTGCTTAAAACCCTCTCCTATAGCCGGGCAGTGGTGGTGCATGCCTTTATCTCAGCACTTAGAGAATTTCTGAGTTCAAGGCCAGCCTGGTCTATA

GAGTGAGTTACAGAACAGCCAGAGCTATACGGAGAAACCCTGTCTCAGATAAACAAACAAACAAACAAACAAACCCTCTCCTGTGTTTTCCAATAATACA

GAATGAAGTTCAAGTTTCTTTTCCTAACAGTCAATTAAGCTGAACCCTGCTTAGTCCCCGACCCCCAACTCTAAACACTCAACTCATACTGAATGCAGAG

TGACACCTTGAGTCACACTGAGAGCTGAGTCACACCTGTGTCTCTTTTCCTCAAACATCCTTTCCCTCAGCCTCTGTTTTCATCATTCTGTGAGTCACCG

AATCTCAAAGAGCAGACCCCAGACTGTCAGATTCCCCACCTCTCCAGAAACCTCTTAGAATGGAAAACTAACCCAAGCCAGACATTTCACCGAGACTCAG

CGGTCCTGGACTTAACAAGCCTTTCACATCATTCTGCATGCTCCTGTTTGAAAACAACTACTATCTGGCCCATGCAGCAGGCCAAATCATCTTGTGTTCC

CGCCCTCTCCCTTCATCCATGTTAGACTCCCGTGGACGTAAATCTATCTCCCTTGTCTAATCAGACTCGATTGTTTTTAATGATTTAGGCCTTGTGCTCT

AGAATGGTACCAATCCAGTATCAATGTATGACAAGTGCTTGTTAAATAAAGAAGCGAACC
Translation
MDPFPDLYATPGDSLDHFLEHSLQPQRDWKEEGQDAWERIERFFREQCFRDELLLDQEVRVIKVVK GGSSGKGTTLNHRSDQDMILFLSCFSSFEEQAR

NREVVISFIKKRLIHCSRSLAYNIIVLTHREGKRAPRSLTLKVQSRKTDDIIWMDILPAYDALG GPISRDSKPAPAIYETLIRSKGYPGDFSPSFTELQ

RHFVKTRPVKLKNLLRLVKFWYLQ CLRRKYGRGAVLPSKYALELLTIYAWEMGTESSDSFNLDEGFVAVMELLVNYRDICIYWTKYYNFQNEVVRNFLK

KQLKGDR RPIILDPADPTNNLGRRKGWEQVAAEAAFCLLQVCCTTVGPSERWNVQ - UNI14098 - RARDVQVRVKQTGTVDWTLWTNPYSPIRKM

KAEIRREKNFGGELRISFQEPGGERQLLSSRKTLADYGIFSKVNIQVLETFPPEILVFVKYPGGQSKPFTIDPDDTILDLKEKIEDAGGPCAEDQVLLLD

DEELEDDESLKELEIKDCDTIILIRVID

For any suggestions or comments, please send an email to unitrap@crg.es