Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029596 (Sdsl)
Chromosomal location
Chr 5: 120908211 - 120922819 (-)
Description
serine dehydratase-like Gene [Source:MGI (curated);Acc:Sdsl-002]
RefSeq_dna
NM_133902 
RefSeq_peptide
NP_598663.2 
UniGene
Mm.5162 
MGI
MGI:2182607 
Uniprot/SWISSPROT
Q8R238 
Human Ortholog
ENSG00000139410 (SDSL)
Omim not available
UniTrap UNI13979
Vector Insertion
Chr 5: 120908561 - 120909453
Public Clones CMHD-GT_181H9-3 (cmhd) CMHD-GT_181E11-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21675
Vector Insertion
Chr 5: 120908210 - 120908561
Public Clones not available
Private Clones OST321458 (lexicon) OST312798 (lexicon) OST21423 (lexicon) OST18571 (lexicon)
OST13455 (lexicon)
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000052258
Sequence
GGCCTTCCTGATTCTGTCTCACGTGGCTTCGTTCTTAGGTAAG GTGGTCAGCGCGCTGCTGGAATGGAGGGGGCCTTGGCAGAACGCGTCGGGGCGGAG

CCTTTCCACAGGGTCACGCCCCTGCTGGAGAGCTGGGCGCTGTCTCAGGTGGCAGGCATGCCGGTCTTCCTCAAATATGAGAATGTGCAGATAGCTGGCT

CCTTTAAGATTCGGGGCATCGGACATTTCTGCCAGCAG ATGGCCAAGAGGGGATGCAGACATCTGGTGTGCTCCTCAG GGGGCAATGCGGGCATTGCG

GCTGCATACTCGGCTCGTAAGCTGGGCATCCCCGTCACCATCGTGCTCCCAGAGGGCACCTCCGTGCAGGTGGTGAGGCGGCTCGAGGGGGAAGGGGCCG

AGGTCCAGCTGACTGGGAAA GTCTGGGATGAAGCCAATGTAAAAGCACAAGAACTGGCCACAAGGGATGGCTGGGTGAACGTCTCCCCGTTTGACCATC

CCCTTATATG GGAAGGCCATGCCAGCCTAGTGCGGGAGCTGAAGGAGTCACTAGGGACCCCTCCAGGTGCTGTGGTGCTGGCCGTGGGGGGCGGAGGGC

TCCTGGCAGGTGTGACTGCTGGCCTGCTGGAGGTGGGCTGGCAGCATGTGCCCATCGTTGCCATGGAGACCCGCGGGGCGCACAGTTTCAATTCGGCCTT

GCAGGCAGGCAGGCCGGTCACCCTGCCAGACATCACCAG TGTAGCCAAGAGCCTCGGAGCCAAGACGGTGGCTGCACGGACCTTGGAGTGTGCAAAGGA

GTGTGAGGTCCTCTCTGAGGTGGTAGAAGACCGGGAGGCTGTCAGCGCTGTGCAGAGGTTCCTGG - UNI13979 - - UNI21675 - ACGATGAG

CGCATGCTGGTGGAACCTGCCTGCGGTGCCGCCCTGGCCGCCATCTACTCGGGCATCCTGTGGAGGCTCCAGGCTGAGGGCCGCCTGAGTTCTGCCCTAG

CTTCCGTTGTGGTCATCGTGTGCGGTGGCAACAACATTAGTAGCCAACAGCTTCAGGAGCTGAAAATCCAGCTGGGCTGCAGCTGAAGAATCTCAGGAAC

TCCCCCAGAGGTTCCTGGACACCTTGGTGGGTCACTCAAGGGACCTCGGTTCCAGTGGTCCTGCCCTCTTCCTTCCAGGTAGCCCTCCTGGGTTGCTCTC

AGTGGCTCCCTGCTGTCCAGTGAATAAACCTGACTGAGCTG
Translation
 MEGALAERVGAEPFHRVTPLLESWALSQVAGMPVFLKYENVQIAGSFKIRGIGHFCQQ MAKRGCRHLVCSSG GGNAGIAAAYSARKLGIPVTIVLPE

GTSVQVVRRLEGEGAEVQLTGK VWDEANVKAQELATRDGWVNVSPFDHPLIW WEGHASLVRELKESLGTPPGAVVLAVGGGGLLAGVTAGLLEVGWQH

VPIVAMETRGAHSFNSALQAGRPVTLPDITS SVAKSLGAKTVAARTLECAKECEVLSEVVEDREAVSAVQRFLD - UNI13979 - - UNI21675 

- DDERMLVEPACGAALAAIYSGILWRLQAEGRLSSALASVVVIVCGGNNISSQQLQELKIQLGCS
Transcript ENSMUST00000031594
Sequence
GAAGACCTTGACAGAAAACCTCACACCCCAAGGGCACATGCAGAAGAGGCCTTCCTGATTCTGTCTCACGTGGCTTCGTTCTTAG ATGAGCCCAGGTCG

TTCATGAGCCATGAGCTGCGTAAGGAAGACAGAGAGGATTGAATACCCCCACGGGTTCATCTTGGTCATTTTTTGTTGTGAGTTCTCACCAGGACCCCAG

AATCAGGAGCTGTCCCTTTAACAAGGAGGAGGGGCCAGGCCCTGGTAGCCGGAAGCTGATCTGGTAGCCAGTGCGTCCAGGTTGGTCCTGGCTGGGCTGT

CCTTCAGGAAG GTGGTCAGCGCGCTGCTGGAATGGAGGGGGCCTTGGCAGAACGCGTCGGGGCGGAGCCTTTCCACAGGGTCACGCCCCTGCTGGAGAG

CTGGGCGCTGTCTCAGGTGGCAGGCATGCCGGTCTTCCTCAAATATGAGAATGTGCAGATAGCTGGCTCCTTTAAGATTCGGGGCATCGGACATTTCTGC

CAGCAG ATGGCCAAGAGGGGATGCAGACATCTGGTGTGCTCCTCAG GGGGCAATGCGGGCATTGCGGCTGCATACTCGGCTCGTAAGCTGGGCATCCC

CGTCACCATCGTGCTCCCAGAGGGCACCTCCGTGCAGGTGGTGAGGCGGCTCGAGGGGGAAGGGGCCGAGGTCCAGCTGACTGGGAAA GTCTGGGATGA

AGCCAATGTAAAAGCACAAGAACTGGCCACAAGGGATGGCTGGGTGAACGTCTCCCCGTTTGACCATCCCCTTATATG GGAAGGCCATGCCAGCCTAGT

GCGGGAGCTGAAGGAGTCACTAGGGACCCCTCCAGGTGCTGTGGTGCTGGCCGTGGGGGGCGGAGGGCTCCTGGCAGGTGTGACTGCTGGCCTGCTGGAG

GTGGGCTGGCAGCATGTGCCCATCGTTGCCATGGAGACCCGCGGGGCGCACAGTTTCAATTCGGCCTTGCAGGCAGGCAGGCCGGTCACCCTGCCAGACA

TCACCAG TGTAGCCAAGAGCCTCGGAGCCAAGACGGTGGCTGCACGGACCTTGGAGTGTGCAAAGGAGTGTGAGGTCCTCTCTGAGGTGGTAGAAGACC

GGGAGGCTGTCAGCGCTGTGCAGAGGTTCCTGG - UNI13979 - - UNI21675 - ACGATGAGCGCATGCTGGTGGAACCTGCCTGCGGTGCCGC

CCTGGCCGCCATCTACTCGGGCATCCTGTGGAGGCTCCAGGCTGAGGGCCGCCTGAGTTCTGCCCTAGCTTCCGTTGTGGTCATCGTGTGCGGTGGCAAC

AACATTAGTAGCCAACAGCTTCAGGAGCTGAAAATCCAGCTGGGCTGCAGCTGAAGAATCTCAGGAACTCCCCCAGAGGTTCCTGGACACCTTGGTGGGT

CACTCAAGGGACCTCGGTTCCAGTGGTCCTGCCCTCTTCCTTCCAGGTAGCCCTCCTGGGTTGCTCTCAGTGGCTCCCTGCTGTCCAGTGAATAAACCTG

ACTGAGCTGA
Translation
  MEGALAERVGAEPFHRVTPLLESWALSQVAGMPVFLKYENVQIAGSFKIRGIGHFCQQ MAKRGCRHLVCSSG GGNAGIAAAYSARKLGIPVTIVLP

EGTSVQVVRRLEGEGAEVQLTGK VWDEANVKAQELATRDGWVNVSPFDHPLIW WEGHASLVRELKESLGTPPGAVVLAVGGGGLLAGVTAGLLEVGWQ

HVPIVAMETRGAHSFNSALQAGRPVTLPDITS SVAKSLGAKTVAARTLECAKECEVLSEVVEDREAVSAVQRFLD - UNI13979 - - UNI21675

 - DDERMLVEPACGAALAAIYSGILWRLQAEGRLSSALASVVVIVCGGNNISSQQLQELKIQLGCS

For any suggestions or comments, please send an email to unitrap@crg.es