Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029603 (Dtx1)
Chromosomal location
Chr 5: 121130273 - 121161678 (-)
Description
deltex 1 homolog (Drosophila) Gene [Source:MGI (curated);Acc:Dtx1-001]
RefSeq_dna
NM_008052 
RefSeq_peptide
NP_032078.2 
UniGene
Mm.1645 
MGI
MGI:1352744 
Uniprot/SWISSPROT
Q61010 
Uniprot/SPTREMBL
Q5DTK6 
Human Ortholog
ENSG00000135144 (DTX1)
Omim not available
UniTrap UNI36012
Vector Insertion
Chr 5: 121144418 - 121160985
Public Clones IST14559F4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26424
Vector Insertion
Chr 5: 121133758 - 121144418
Public Clones not available
Private Clones OST118952 (lexicon)
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13676
Vector Insertion
Chr 5: 121133466 - 121133695
Public Clones CMHD-GT_272A2-3 (cmhd) CMHD-GT_507D10-3 (cmhd) CMHD-GT_269A9-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26444
Vector Insertion
Chr 5: 121133132 - 121133303
Public Clones not available
Private Clones OST117799 (lexicon)
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000031607
Sequence
GGGATCCCAGCGACGCGTCCGACGCGTCCGCGCGCCAGGACTACTGCGTCCTCCTGTCTGTCTGTCTATCCGGCGGCGGGCGAGGTCCGGGCTGGGGCAA

AGCGGTGCCCTCCTTCCCTCCCTCCCGGGAGCCAGCGGAGAAAGAGTCAGCGGGGGGTGAAAAGAGCCAGCGCGGGGAGATCACG - UNI36012 - G

TCGCGAACACCAGTGGGGTGGGGCGTGCCCACGGCCCCCGCCCCTCCCCAGGGTCCCCCAGCTGCAGGTCCGGACCGCGATCCCCACGCTCCGCCCCCTT

CCCTGGGAGATCTACCACCACTCAGGCCGGCCAGGAGAGGGGACAGGGGTGCAGGGGTGCAGGGAGCCCCGTCGGGAGGGGCGGACCCAAGTCACCCCGA

AGCGAGGCACGGGATCTGGAAAGCGGAGCCAAGCGCGCAAGGAGCAGCAGGCTGGGGCCAGGGCCTCCTGGGTGACAAGGCCCTGCGTGGCGGACAGAAG

GAACGGGAGAGAAGCAGGGACAGGCCGGACTTAGAGGGGCAAGTGCCTCCTCACTCCTGCACCTGCACTGAGGGGACTAAGGGATTGAGATCATGTCCCC

CACCTAGGACAGACATTGCCTACCGCGCACCGCTGTGTGCAACAGCTGCGCTCTGCGGGAAGGGGTCCTCGCAGCGTCTGGATGGCCACCCATCCCCCTA

ACCCAGGCCTCTAGGCCTTGGAGACGAGCCCAGCTGGAAAAGAGGCCACACTCCTCGCCGCCCGCCCTGGAGAGGGAGGACGAAGCTTCCCCGGTGCTCC

CAGGCCCAGGAGGAGCTGGGCCAGCAACAGTGGGGACCTGGCCCCGCAGGCGGCAGCGGCCATGTCACGGCCAGGCCAAGGTGTGATGGTGCCGGTGAAC

GGGCTGGGCTTCCCGCCGCAGAACGTGGCCAGGGTGGTGGTGTGGGAGTGGCTCAATGAGCACAGCCGCTGGCGACCCTACACGGCCACCGTGTGCCACC

ACATCGAGAATGTTCTTAAGGAGGATGCCCGGGGCTCTGTGGTCCTTGGCCAGGTGGACGCCCAGCTGGTGCCCTACATCATCGACCTACAATCCATGCA

TCAGTTCCGGCAAGACACAG - UNI36012 - GTACCATGCGGCCGGTGCGACGCAACTTCTACGATCCATCGTCGGCGCCGGGCAAGGGCATCGTGT

GGGAATGGGAGAACGACGGCGGGGCGTGGACGGCCTACGACATGGACATCTGCATCACCATCCAGAACGCGTACGAGAAGCAGCACCCGTGGCTCGACCT

CTCATCGCTCGGCTTCTGCTACCTCATCTACTTCAACAGCATGTCCCAGATGAACCGCCAGACGCGCCGCCGCCGCCGCCTGCGCCGTCGCCTGGACCTG

GCTTACCCGCTCACTGTCGGCTCCATTCCCAAGTCGCAATCCTGGCCCGTGGGAGCCAGCTCGGGTCAGCCCTGCTCCTGTCAGCAGTGCCTGCTGGTCA

ACAGCACGCGCGCCGCCTCCAACGCCATCCTGGCCTCGCAGCGCCGCAAGGCTCCCATTGCGCCAGCCGCGCCTCCAGCGCCCCCTCCGCCCCCGCCGCC

GCTGCCACCCGGAGGACCTCCGGGTGCGCTCGTTGTGCGCCCCAGCGCCACTTTCGCCGGAGCTGCGCTCTGGGCCGCACCTGCCACCGGCCCCACGGAG

CCTGCGCCGCCTCCAGGAGTTCCCCCAAGGAGCCCTAGTGCCCCCAACGGAGCGCCCACACCGGGCCAAAACAACCTCAGTCGACCAGGACCACAGAGGT

CCACCAGCGTCAGCGCACGCGCCTCTATCCCGCCTGG - UNI26424 - - UNI36012 - GGTTCCGGCGCTCCCCGTGAAGAACTTGAATGGCAC

TGGCCCTGTCCACCCAGCCTTGGCAG - UNI13676 - GGATGACCGGGATCCTGCTGTGTGCAGCGGGGCTGCCGGTGTGCCTGACACGAGCACCCA

AACCCATCCTGCACCCACCACCAGTAAGCAAAAGCGACGTGAAGCCTGTGCCTGGAGTGCCCGGCGTGTGCCGCAAGACCAAGAAGAAACACCTCAAGAA

AA - UNI26444 - GCAAGAATCCTGAGGATGTGGTTCGGAGGTACATGCAGAAGGTGAAAAACCCGCCTGATGAG GACTGTACCATTTGCATGGAG

CGGCTGGTCACAGCATCTGGCTATGAGGGCGTGCTCCGAAACAAGAGTGTGCGGCCCGAGCTTGTGGGCCGCCTGGGCCGCTGCGGCCACATGTATCACC

TGCTCTGCCTGGTGGCCATGTACTCCAATGGCAACAAG GATGGCAGCCTGCAGTGTCCAACCTGCAAAGCCATCTACGGGGAGAAGACAGGGACACAGC

CACCAGGGAAGATGGAGTTTCACCTCATCCCGCACTCGCTGCCTGGTTTTGCAGACACCCAGACGATCCGCATCGTCTATGACATCCCCACGGGCATCCA

G GGCCCTGAACATCCCAACCCAGGCAAGAAGTTCACAGCCAGAGGCTTCCCTCGCCACTGCTACCTACCCAACAATGAGAAGGGCCGAAAG GTGCTGA

GATTGCTCATCACCGCCTGGGAACGCAGACTCATCTTCACTATCGGAACATCCAACACCACGGGCGAGTCGGACACCGTGGTGTGGAACGAGATTCACCA

CAAGACGGAGTTTGGTTCCAACCTCACTGGTCACGGCTACCCCGACGCCAGCTACCTAGACAACGTGCTGGCTGAGCTCACCGCCCAGGGGGTTTCTGAG

GCCATGGCCAAGGCCTGAGGCCTGAGTTGCCCGCCTTCCCTTTTGCCTTGCCTCTAGCCTGGCACATGCCTCCCTCCGCTCTCGGCGGGAGGAGCCAGAA

GCGCTAAGGGGATCTGGCTGGTGGCTGTGGGGGGGGTGATGGGAGTCCACCAGGCCAGCTGGCTCCAACCTGTGGCTTCCGGCAAGAGCAGCAGAGATAG

GACCACCAGCAAGGGCGACTTCCCTATGGAAAACGATGGCGCTTTGCCCTTCACACCACACACAAACGCACACGTGTCCTGTTGCACGCACGCACTCACG

CACGTACACCACGTGCCTCTCCACTTCTCCCAGCTTGGGGAGAAAGAGACAGAAAGGCCCCCATGACATGTCCTGTGGAAATACCTGTGTCTCCATTACA

TCTGTATAGGCTCGTCCCTTTCCCAGGACTTGAGTCAAGCACGGGATAGTGGGGGGGACTCTGTAAGGCTTCAAGGGGTCGCTCTGCCCCTGGGCCTCAA

CCCCTTAACCCACGTCAGCGCTGCCACCTGCCCACTGAGCACTGCAAAGCCAATGGGGTAGAAACCCCAGGTTATTAAGTAGCTTTTCGCAGGCCACTGG

GGACGAGGCTATCTTAACTTTGTGCTTGTGTCTATCTTTCCCGGGACCCTGACTTCTTCTTCTTCCTGTGTCCATCTCTTGACCTCTGTCTATCCCAGGC

AAAGACATCGTCCTTGCCTCTGTACCGGCTTCTCCCCCACTAAACCGCTCCGGACATTTGAGACCCACTTCTGGCTTCAGGAGCGAGGGGAGGAGGCCTT

GTTCAGGCTATACACGCATCAAGCTGAGCAGGCAGCAAAGCGTTAAACTTCTCCCTGCTTGAAAGTGGGCGGTGGGCGGCTGATCGTCTCAGGCCAACCA

GAGGCCCGTTGCCCAGGCAACTCACCAGCTCCGCCTCTGAGGATTGGCTGCTGGGATGGAAGTCAGCCAAGCTTTAAAGGGACGCCAGCAATTGCTCTTT

TG
Translation
 - UNI36012 - MSRPGQGVMVPVNGLGFPPQNVARVVVWEWLNEHSRWRPYTATVCHHIENVLKEDARGSVVLGQVDAQLVPYIIDLQSMHQFRQDT

G - UNI36012 - GTMRPVRRNFYDPSSAPGKGIVWEWENDGGAWTAYDMDICITIQNAYEKQHPWLDLSSLGFCYLIYFNSMSQMNRQTRRRRRLRR

RLDLAYPLTVGSIPKSQSWPVGASSGQPCSCQQCLLVNSTRAASNAILASQRRKAPIAPAAPPAPPPPPPPLPPGGPPGALVVRPSATFAGAALWAAPAT

GPTEPAPPPGVPPRSPSAPNGAPTPGQNNLSRPGPQRSTSVSARASIPPG - UNI26424 - - UNI36012 - GVPALPVKNLNGTGPVHPALAG 

- UNI13676 - GMTGILLCAAGLPVCLTRAPKPILHPPPVSKSDVKPVPGVPGVCRKTKKKHLKKS - UNI26444 - SKNPEDVVRRYMQKVKNP

PDE DCTICMERLVTASGYEGVLRNKSVRPELVGRLGRCGHMYHLLCLVAMYSNGNK DGSLQCPTCKAIYGEKTGTQPPGKMEFHLIPHSLPGFADTQT

IRIVYDIPTGIQ GPEHPNPGKKFTARGFPRHCYLPNNEKGRK VLRLLITAWERRLIFTIGTSNTTGESDTVVWNEIHHKTEFGSNLTGHGYPDASYLD

NVLAELTAQGVSEAMAKA

For any suggestions or comments, please send an email to unitrap@crg.es