Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029635 (Cdk8)
Chromosomal location
Chr 5: 147042826 - 147114450 (+)
Description
cyclin-dependent kinase 8 Gene [Source:MGI (curated);Acc:Cdk8]
RefSeq_dna
NM_153599 
RefSeq_peptide
NP_705827.2 
UniGene
Mm.260576 Mm.363573 Mm.401804 
MGI
MGI:1196224 
Uniprot/SWISSPROT
Q8R3L8 
Uniprot/SPTREMBL
Q5U427 
Human Ortholog
ENSG00000132964 (CDK8)
Omim not available
UniTrap UNI30222
Vector Insertion
Chr 5: 147043397 - 147071080
Public Clones D073B02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28357
Vector Insertion
Chr 5: 147071157 - 147079790
Public Clones (sanger) IST14135B1 (tigm) IST12755F10 (tigm) IST15054A7 (tigm) IST10906F9 (tigm)
IST14842F4 (tigm) IST14888C11 (tigm) IST11968F10 (tigm) IST14445D5 (tigm)
IST11529B5 (tigm) IST15088E9 (tigm)
Private Clones OST32975 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1297
Vector Insertion
Chr 5: 147079790 - 147079863
Public Clones DC0441 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32818
Vector Insertion
Chr 5: 147079902 - 147083170
Public Clones IST11593D6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7720
Vector Insertion
Chr 5: 147083170 - 147083241
Public Clones RRS314 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000031640
Sequence
GCCTTGGAGGCTGTGACAATGGACTATGACTTTAAAGTGAAGCTGAGCAGCGAGCGGGAGCGGGTCGAGGACCTGTTTGAATACGAGGGCTGCAAAGTTG

GTCGAGGCACTTACGGGCACGTCTACAAGGCGAAGAGGAAAGATGG - UNI30222 - GAAGGACGATAAAGACTACGCTTTAAAACAAATAGAAGGA

ACTGGAATTTCTATGTCGGCATGCAGAGAGATAGCA - UNI1297 - - UNI28357 - TTACTCCGAGAGCTTAAGCACCCAAACGTCATCTCCCT

TCTGAAGGTGTTTCTGTCTCATGCTGATCGGAAAGTATGGCTTCTCTTTGACTATGCTGAGCATGACCTCTGG - UNI7720 - - UNI32818 - C

ATATAATTAAGTTTCACAGAGCTTCGAAAGCCAACAAGAAGCCAGTTCAGTTACCTCGGGGAATGGTGAAGTCACTGTTGTACCAGATCCTAGATGGGAT

TCACTATCTTCATGCCAACTGGGTGTTGCACAGGGATTTG AAACCTGCTAATATTTTAGTTATGGGTGAAGGTCCTGAGCGAGGAAGAGTAAAAATTG 

CTGACATGGGCTTTGCCCGATTATTTAATTCACCTTTGAAGCCTTTAGCAGATTTGGATCCAGTGGTTGTAACATTCTGGTACCGAGCTCCAGAATTACT

CCTCGGAGCGCGACATTATACCAAAGCAATTG ATATTTGGGCTATAGGGTGTATATTTGCAGAACTACTAACGTCAGAACCAATATTTCACTGTCGACA

AGAGGACATCAAAACTAGTAATCCTTATCACCATGACCAGCTGGACAGAATATTCAATGTAATGGGATTCCCTGCAG ATAAAGATTGGGAAGATATAAA

AAAGATGCCCGAACATTCAACATTAATGAAAGATTTCAGAAGAAATAC GTATACCAATTGCAGCCTTATCAAGTATATGGAAAAGCATAAAGTTAAACC

CGATAGTAAAGCATTCCACTTG CTTCAGAAGTTGCTCACTATGGACCCAATAAAGCGAATTACCTCAGAGCAGGCCATGCAGGACCCCTACTTCCTAGA

AGACCCACTTCCCACGTCAGA TGTTTTCGCCGGTTGTCAGATCCCATATCCCAAACGAGAATTTTTAACAGAAGAAGAGCCTGATGAGAAAGGAGACAA

A AAGACCCAGCAGCAGCAGCAGGGCAACAACCACACTAACGGAACTGGCCATCCGGGGAACCAGGACAGCGGCCACGCACAGGGGCCCCCCTTGAAAAA

AGTGAGAGTTGTCCCTCCTACCACTACCTCAGGTGGACTCATCATGACCTCCGACTATCAG CGTTCCAATCCACATGCTGCTTATCCCAACCCTGGACC

AAGCACATCACAGCCCCAGAGCAGCATGGGATACTCAGCTACCTCCCAGCAGCCTCCACAGTACTCACATCAGACACATCGGTACTGAGCTGTGCTGGAG

TCTGTCAGTGCACTGTTGCTCATGCTGCAGGACTGGCTGCGGCACTCGCGGGAACCTGGTGTGGGCCATGCGAATGTACTGTACAACCACATCTTCACAA

TGTCCAGTAGCCGAGTTCCACCAGTTGTCACAGATTGGGGTGGTAGCTTCCAGGTTGTACCTAAGTTTGGAGTTAGACTTGAAATGAAAGTGCTAGCACA

GTTGTGTTGTGGGTTTGCTACTTCCATAGTTTACTTGACATGGTTCAGACTGACCAAGCATAGTTTTCAGTGACAGTCTGTAGCAGTTGAAGCTGTGAAA

TGTGCTAGGGCGAGCATTTGTCCTCGTGTGTGGTGACTTTGAGTGTAACAGCGTGATCTGACCAATAGTACACACAGACGCAAGGTTTAACTGGTACTTG

AAACACAGATTATGTTAACAAAATAACCAAGATTTAAAGATTATTTTGGTACACCTTTCTTTTTAGTGTCTTATCAGTGGGTTGATTCATCTTCTACATA

AATCAGTGTTTTATGACCAAGAATATTGCTTGGATTGTTTTGAAAGTACAAAAGAACCACATAGTTTCTACTGACAGGTTTCAGAGCTCCCAAAGATTAA

TTTCCAACTTAGAGGTTTGTTTTTATTTTCAACCTATGACGACTTGACTGGTCTTAAAGCTGCTATTTGATAGTAATTAAATATGTTGTCATTGATAGAA

GCCTGTTGGTTCAGCAAACTGAAATGAGTGTTGCAGACAGGGTTTTCTTTTCCTCGTTGGTGTTGCTGATTTGTGAGCATGCTTTCTGAATACAAAAGCA

TGAGTGGCGACCTCCGTGAGGCACGGTGACCTCCTCGAGGCACGGTGACCTCTGCGAGGCACGGCGTCAGTCCGCACTCTTCTGTCCTGATTTGAAGCTG

CCTAGTGTAGTGCTATTACAATTTTGTTCAGTTAACTTTCTTTTTAAAAGGTTGTTCGCACATTTTTAGGGTGCCCTTACTTCAGCAAAGGAGAGGGAGT

AGGAGAGCCTTAGAACTTTTGAGGGGAAAATAAAAAGCTATAACATACAACGTACTGTATCAAACTATTTTACATGAATGACACAAGTATTCTGAATAAA

AAAAAATTGAACATTGTTAAAAACAAGGTGTTATGTAATAAATTTATTTTTCATAAATCAA
Translation
MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDG - UNI30222 - GKDDKDYALKQIEGTGISMSACREIA - UNI1297 - - UN

I28357 - LLRELKHPNVISLLKVFLSHADRKVWLLFDYAEHDLW - UNI7720 - - UNI32818 - HIIKFHRASKANKKPVQLPRGMVKSLLY

QILDGIHYLHANWVLHRDL KPANILVMGEGPERGRVKIA ADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAID DIWAIGCIFAELL

TSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPAD DKDWEDIKKMPEHSTLMKDFRRNT TYTNCSLIKYMEKHKVKPDSKAFHL LQKLLTMDPIKR

ITSEQAMQDPYFLEDPLPTSD DVFAGCQIPYPKREFLTEEEPDEKGDK KTQQQQQGNNHTNGTGHPGNQDSGHAQGPPLKKVRVVPPTTTSGGLIMTS

DYQ RSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY
Transcript ENSMUST00000110606
Sequence
CGCGTCGCACCCGCAGCAGCACGCGCGGCCAACCGCGCGCGAGCCGGCGCCCCGGGAGCGCGGGGACAAGGGCGGACGCTGCTCCCCGCCCCCAGCGCGT

CCCTCGGCTGTCGCGCGCCCGCGGGGACCGCCCGGCGCTCCCCTGGATGTCCCCGGCGCCCGCGCGGGGCCTCCTGCCGTCGCCTCGTGAGGCGGGCTGG

TGCTGCGGCCGGCGGGTGTAGCTCGGGGGCTGCGGCTGCTGCGCGGCCCGGTCCCCACCGCGGCCCTCGGCCCCCCGCCCCAGCACCCCGGCCTTGGAGG

CTGTGACAATGGACTATGACTTTAAAGTGAAGCTGAGCAGCGAGCGGGAGCGGGTCGAGGACCTGTTTGAATACGAGGGCTGCAAAGTTGGTCGAGGCAC

TTACGGGCACGTCTACAAGGCGAAGAGGAAAGATGG - UNI30222 - GAAGGACGATAAAGACTACGCTTTAAAACAAATAGAAGGAACTGGAATTT

CTATGTCGGCATGCAGAGAGATAGCA - UNI1297 - - UNI28357 - TTACTCCGAGAGCTTAAGCACCCAAACGTCATCTCCCTTCTGAAGGTG

TTTCTGTCTCATGCTGATCGGAAA - UNI1297 - - UNI7720 - - UNI32818 - CATATAATTAAGTTTCACAGAGCTTCGAAAGCCAACAA

GAAGCCAGTTCAGTTACCTCGGGGAATGGTGA
Translation
MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDG - UNI30222 - GKDDKDYALKQIEGTGISMSACREIA - UNI1297 - - UN

I28357 - LLRELKHPNVISLLKVFLSHADRK - UNI1297 - - UNI7720 - - UNI32818 - HIIKFHRASKANKKPVQLPRGMV
Transcript ENSMUST00000110605
Sequence
GGAGGAGCTACCGGCTGTTGTGTGGCGTCGCTGGTCTGTCCGGGCGGATGGCAGCCTGAGTGTTCGTGAGCGCGTGTGGGAGAAG - UNI30222 - G

AAGGACGATAAAGACTACGCTTTAAAACAAATAGAAGGAACTGGAATTTCTATGTCGGCATGCAGAGAGATAGCA - UNI1297 - - UNI28357 -

 TTACTCCGAGAGCTTAAGCACCCAAACGTCATCTCCCTTCTGAAGGTGTTTCTGTCTCATGCTGATCGGAAAGTATGGCTTCTCTTTGACTATGCTGAG

CATGACCTCTGG - UNI7720 - - UNI32818 - CATATAATTAAGTTTCACAGAGCTTCGAAAGCCAACAAGAAGCCAGTTCAGTTACCTCGGGG

AATGGTGAAGTCACTGTTGTACCAGATCCTAGATGGGATTCACTATCTTCATGCCAACTGGGTGTTGCACAGGGATTTG AAACCTGCTAATATTTTAGT

TATGGGTGAAGGTCCTGAGCGAGGAAGAGTAAAAATTG CTGACATGGGCTTTGCCCGATTATTTAATTCACCTTTGAAGCCTTTAGCAGATTTGGATCC

AGTGGTTGTAACATTCTGGTACCGAGCTCCAGAATTACTCCTCGGAGCGCGACATTATACCAAAGCAATTG GGTGTATATTTGCAGAACTACTAACGTC

AGAACCAATATTTCACTGTCGACAAGAGGACATCAAAACTAGTAATCCTTATCACCATGACCAGCTGGACAGAATATTCAATGTAATGGGATTCCCTGCA

G ATAAAGATTGGGAAGATATAAAAAAGATGCCCGAACATTCAACATTAATGAAAGATTTCAGAAGAAATAC GTATACCAATTGCAGCCTTATCAAGTA

TATGGAAAAGCATAAAGTTAAACCCGATAGTAAAGCATTCCACTTG CTTCAGAAGTTGCTCACTATGGACCCAATAAAGCGAATTACCTCAGAGCAGGC

CATGCAGGACCCCTACTTCCTAGAAGACCCACTTCCCACGTCAGA TGTTTTCGCCGGTTGTCAGATCCCATATCCCAAACGAGAATTTTTAACAGAAGA

AGAGCCTGATGAGAAAGGAGACAAA AAGACCCAGCAGCAGCAGCAGGGCAACAACCACACTAACGGAACTGGCCATCCGGGGAACCAGGACAGCGGCCA

CGCACAGGGGCCCCCCTTGAAAAAAGTGAGAGTTGTCCCTCCTACCACTACCTCAGGTGGACTCATCATGACCTCCGACTATCAG CGTTCCAATCCACA

TGCTGCTTATCCCAACCCTGGACCAAGCACATCACAGCCCCAGAGCAGCATGGGATACTCAGCTACCTCCCAGCAGCCTCCACAGTACTCACATCAGACA

CATCGGTACTGAGCTGTGCTGGAGTCTGTCAGTGCACTGTTGCTCATGCTGCAGGACTGGCTGCGGCACTCGCGGGAACCTGGTGTGGGCCATGCGAATG

TACTGTACAACCACATCTTCACAATGTCCAGTAGCCGAGTTCCACCAGTTGTCACAGATTGGGGTGGTAGCTTCCAGGTTGTACCTAAGTTTGGAGTTAG

ACTTGAAATGAAAGTGCTAGCACAGTTGTGTTGTGGGTTTGCTACTTCCATAGTTTACTTGACATGGTTCAGACTGACCAAGCATAGTTTTCAGTGACAG

TCTGTAGCAGTTGAAGCTGTGAAATGTGCTAGGGCGAGCATTTGTCCTCGTGTGTGGTGACTTTGAGTGTAACAGCGTGATCTGACCAATAGTACACACA

GACGCAAGGTTTAACTGGTACTTGAAACACAGATTATGTTAACAAAATAACCAAGATTTAAAGATTATTTTGGTACACCTTTCTTTTTAGTGTCTTATCA

GTGGGTTGATTCATCTTCTACATAAATCAGTGTTTTATGACCAAGAATATTGCTTGGATTGTTTTGAAAGTACAAAAGAACCACATAGTTTCTACTGACA

GGTTTCAGAGCTCCCAAAGATTAATTTCCAACTTAGAGGTTTGTTTTTATTTTCAACCTATGACGACTTGACTGGTCTTAAAGCTGCTATTTGATAGTAA

TTAAATATGTTGTCATTGATAGAAGCCTGTTGGTTCAGCAAACTGAAATGAGTGTTGCAGACAGGGTTTTCTTTTCCTCGTTGGTGTTGCTGATTTGTGA

GCATGCTTTCTGAATACAAAAGCATGAGTGGCGACCTCCGTGAGGCACGGTGACCTCCTCGAGGCACGGTGACCTCTGCGAGGCACGGCGTCAGTCCGCA

CTCTTCTGTCCTGATTTGAAGCTGCCTAGTGTAGTGCTATTACAATTTTGTTCAGTTAACTTTCTTTTTAAAAGGTTGTTCGCACATTTTTAGGGTGCCC

TTACTTCAGCAAAGGAGAGGGAGTAGGAGAGCCTTAGAACTTTTGAGGGGAAAATAAAAAGCTATAACATACAACGTACTGTATCAAACTATTTTACATG

AATGACACAAGTATTCTGAATAAAAAAAAATTGAACATTGTT
Translation
 - UNI30222 - MSACREIA - UNI1297 - - UNI28357 - LLRELKHPNVISLLKVFLSHADRKVWLLFDYAEHDLW - UNI7720 - - 

UNI32818 - HIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDL KPANILVMGEGPERGRVKIA ADMGFARLFNSPLKPLADLD

PVVVTFWYRAPELLLGARHYTKAIG GCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPAD DKDWEDIKKMPEHSTLMKDFRRNT TYTN

CSLIKYMEKHKVKPDSKAFHL LQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSD DVFAGCQIPYPKREFLTEEEPDEKGDK KTQQQQQGNNHTNGTG

HPGNQDSGHAQGPPLKKVRVVPPTTTSGGLIMTSDYQ RSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY
Transcript ENSMUST00000110604
Sequence
TTTAATAACAAATATTTATTTGTGATTTTTTTTTCCTTCTAGTGATAGAACAAATACTGGCAAGTTTTATGGAACAGAGTAGCAAGGGTAGGCTGACATG

TGATTAGGTGTCGAGCCAGAAGGCCACGGGGTGTAGCCGGAGCTTGAGCACTCCTATGAGAGCCAGTCTTAGAAAGCTCTCAAAGTAATCTTTGTTAGCA

TTCTTGAGACTAGGAGCCTAGGCAACATAAACATTTATCAATGTATTTCACAGATAAAGATTGGGAAGATATAAAAAAGATGCCCGAACATTCAACATTA

ATGAAAGATTTCAGAAGAAATAC GTATACCAATTGCAGCCTTATCAAGTATATGGAAAAGCATAAAGTTAAACCCGATAGTAAAGCATTCCACTTG CT

TCAGAAGTTGCTCACTATGGACCCAATAAAGCGAATTACCTCAGAGCAGGCCATGCAGGACCCCTACTTCCTAGAAGACCCACTTCCCACGTCAGA TGT

TTTCGCCGGTTGTCAGATCCCATATCCCAAACGAGAATTTTTAACAGAAGAAGAGCCTGATGAGAAAGGAGACAAA AAGACCCAGCAGCAGCAGCAGGG

CAACAACCACACTAACGGAACTGGCCATCCGGGGAACCAGGACAGCGGCCACGCACAGGGGCCCCCCTTGAAAAAAGTGAGAGTTGTCCCTCCTACCACT

ACCTCAGGTGGACTCATCATGACCTCCGACTATCAG CGTTCCAATCCACATGCTGCTTATCCCAACCCTGGACCAAGCACATCACAGCCCCAGAGCAGC

ATGGGATACTCAGCTACCTCCCAGCAGCCTCCACAGTACTCACATCAGACACATCGGTACTGAGCTGTGCTGGAGTCTGTCAGTGCACTGTTGCTCATGC

TGCAGGACTGGCTGCGGCACTCGCGGGAACCTGGTGTGGGCCATGCGAATGTACTGTACAACCACATCTTCACAATGTCCAGTAGCCGAGTTCCACCAGT

TGTCACAGATTGGGGTGGTAGCTTCCAGGTTGTACCTAAGTTTGGAGTTAGACTTGAAATGAAAGTGCTAGCACAGTTGTGTTGTGGGTTTGCTACTTCC

ATAGTTTACTTGACATGGTTCAGACTGACCAAGCATAGTTTTCAGTGACAGTCTGTAGCAGTTGAAGCTGTGAAATGTGCTAGGGCGAGCATTTGTCCTC

GTGTGTGGTGACTTTGAGTGTAACAGCGTGATCTGACCAATAGTACACACAGACGCAAGGTTTAACTGGTACTTGAAACACAGATTATGTTAACAAAATA

ACCAAGATTTAAAGATTATTTTGGTACACCTTTCTTTTTAGTGTCTTATCAGTGGGTTGATTCATCTTCTACATAAATCAGTGTTTTATGACCAAGAATA

TTGCTTGGATTGTTTTGAAAGTACAAAAGAACCACATAGTTTCTACTGACAGGTTTCAGAGCTCCCAAAGATTAATTTCCAACTTAGAGGTTTGTTTTTA

TTTTCAACCTATGACGACTTGACTGGTCTTAAAGCTGCTATTTGATAGTAATTAAATATGTTGTCATTGATAGAAGCCTGTTGGTTCAGCAAACTGAAAT

GAGTGTTGCAGACAGGGTTTTCTTTTCCTCGTTGGTGTTGCTGATTTGTGAGCATGCTTTCTGAATACAAAAGCATGAGTGGCGACCTCCGTGAGGCACG

GTGACCTCCTCGAGGCACGGTGACCTCTGCGAGGCACGGCGTCAGTCCGCACTCTTCTGTCCTGATTTGAAGCTGCCTAGTGTAGTGCTATTACAATTTT

GTTCAGTTAACTTTCTTTTTAAAAGGTTGTTCGCACATTTTTAGGGTGCCCTTACTTCAGCAAAGGAGAGGGAGTAGGAGAGCCTTAGAACTTTTGAGGG

GAAAATAAAAAGCTATAACATACAACGTACTGTATCAAACTATTTTACATGAATGACACAAGTATTCTGAATAAAAAAAAA
Translation
MYFTDKDWEDIKKMPEHSTLMKDFRRNT TYTNCSLIKYMEKHKVKPDSKAFHL LQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSD DVFAGCQIPYP

KREFLTEEEPDEKGDK KTQQQQQGNNHTNGTGHPGNQDSGHAQGPPLKKVRVVPPTTTSGGLIMTSDYQ RSNPHAAYPNPGPSTSQPQSSMGYSATSQ

QPPQYSHQTHRY

For any suggestions or comments, please send an email to unitrap@crg.es