Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029640 (Usp12)
Chromosomal location
Chr 5: 147546388 - 147606532 (-)
Description
ubiquitin specific peptidase 12 Gene [Source:MGI (curated);Acc:Usp12-001]
RefSeq_dna
NM_011669 
RefSeq_peptide
NP_035799.1 
UniGene
Mm.167971 Mm.398464 
MGI
MGI:1270128 
Uniprot/SWISSPROT
Q9D9M2 
Uniprot/SPTREMBL
Q7TNV4 Q80Y43 O88348 
Human Ortholog
ENSG00000152484 (USP12)
Omim not available
UniTrap UNI17399
Vector Insertion
Chr 5: 147580594 - 147606190
Public Clones (sanger) IST14186H11 (tigm) IST13599G1 (tigm)
Private Clones OST443461 (lexicon) OST349253 (lexicon) OST308913 (lexicon) OST250763 (lexicon)
OST233568 (lexicon) OST167779 (lexicon) OST136611 (lexicon) OST46996 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16407
Vector Insertion
Chr 5: 147574991 - 147580512
Public Clones (sanger) IST14596G1 (tigm)
Private Clones OST461640 (lexicon) OST449835 (lexicon) OST388385 (lexicon) OST367046 (lexicon)
OST252443 (lexicon) OST212653 (lexicon) OST65684 (lexicon) OST53833 (lexicon)
OST47010 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37547
Vector Insertion
Chr 5: 147574776 - 147574991
Public Clones (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22920
Vector Insertion
Chr 5: 147565945 - 147566176
Public Clones not available
Private Clones OST281170 (lexicon) OST201473 (lexicon) OST144662 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31337
Vector Insertion
Chr 5: 147565945 - 147574991
Public Clones IST10253B3 (tigm) IST10559B2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19857
Vector Insertion
Chr 5: 147551877 - 147552068
Public Clones not available
Private Clones OST378714 (lexicon)
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38287
Vector Insertion
Chr 5: 147551877 - 147563355
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000085614
Sequence
CCAGCGCGCTGGGCGGGGTGTGCTGTGAGCGGCTTCCCGGGCAGGCGCGGGCCCTGAGGCGGCGGCTGCGCCGTGCGCCGGGGCGGAGCCGGGGGCGGGC

GGGCGGCCGGCGGGCGGGGGCTGGGCCGGAGGAAGCCTGAGCGCCCGCGGCGACGACGGCAGCGGCGGCCCAGCAGGCTAGAAGCGTGGGTCGGCGGCGG

CTCCGGGTGCGGCCGCGGGCTGCGGAGCGAGCGGGCGGCCCGGCTCCCCGCGTCCCCCGCCCGCCGCGACTGTCTGGAAGATGGCGCCGGGCGGATGGAA

ATCCTAATGACAGTCTCCAAATTCGCCTCCATCTGTACCATG - UNI17399 - GGCGCCAATGCCTCGGCATTAGAGAAAGAGATTGGTCCAGAACA

GTTTCCGGTCAACGAGCACTATTTTGGATTAGTCAAT - UNI16407 - - UNI31337 - - UNI37547 - TTTGGGAATACCTGCTACTGCAA

CTCAGTTCTTCAAGCACTTTATTTTTGTCGTCCATTTCGGGAAAAAGTTCTAGCATACAAAAGTCAGCCCAGAAAAAAGGAGAACCTTCTCACCTGCCTG

GCAGACCTCTTCCACAGCATAGCCACCCAGAAGAAGAAGGTCGGCGTGATCCCGCCCAAGAAGTTCATCACAAGGTTGCGGAAAGAAAACG - UNI229

20 - - UNI31337 - - UNI37547 - AGCTGTTTGACAACTACATGCAACAAGATGCCCATGAATTCTTAAATTACCTACTCAATACAATTGCTG

ATATTCTACAAGAAGAAAGAAAACAGGAGAAGCAAAATGGCCGATTACGGAACGGAGACGTGGACAACGAGGATAACAACAGCACACCAGACCCAACCTG

GGTCCACGAGATCTTTCAGGGAACATTAACTAATGAAACCAGGTGTCTTACTTGTGAAACT - UNI22920 - - UNI31337 - ATAAGCAGCAAA

GATGAAGATTTTTTAGACCTTTCTGTTGACGTGGAACAAAACACATCAATTACTCACTGCTTAAG AGGGTTCAGTAACACAGAAACTCTGTGCAGTGAA

TATAAGTACTACTGTGAAGAGTGCCGGAGCAAGCAGGAAGCACACAAGCG - UNI19857 - GATGAAGGTTAAGAAACTGCCCCTGATCCTGGCTCT

GCACCTGAAGAGGTTTAAGTATATGGACCAGCTTCACCGGTACACGAAGCTTTCTTATCGCGTGGTCTTTCCTTTAGAGCTCCGTCTGTTCAACACGTCA

GGAGATGCGACCAACCCTGACAGAATGTATGACCTGGTCGCCGTTGTGGTTCACTGTGGAAG TGGTCCCAACCGAGGCCATTATATTGCAATAGTTAAG

AGTCATGATTTCTGGCTGTTGTTTGATGATGACATTGTAGAA AAAATCGATGCCCAAGCTATTGAAGAATTCTACGGATTGACATCTGACATCTCCAAG

AACTCGGAGTCTGGCTACATCCTTTTCTATCAGTCTCGGGACTGAGAGGAGCCACGGTGGGGAGAAGCTTCTACAAGCTTCTCTGGTTGTTTCAGAAAGG

ATCGAGCGGATGTTCAAGAAGAGAAAGCGAGACAGACAGACAGACAGCCACAGGACGCTCAGGGCAGTAGCTCACTTTGCATACGATAAAGCAAAGACTG

TGGATTAACATGCCCTTCCGGTTACAGTAGTTGAATTTTTTGCTCAGGAATCATGCTGTCTGTGCAGTTCACACAAGGAAGTAAAATCAGAGATACCAGC

TCTCGTGTAAAGCAGCTGCCAGCTGCCAACACATTTTCTGTAGTAATTGCACCAATGATGATTTGAGTTCCTCGGGAGGGCAGTGGAAGAATTAGATGTG

CTAGTCTGATTGAGCACACTGCACTGTGTGCCAGCGTGCGGGATGCGTACACTGTGCATGGGAGCAGTGGCGGTCTTGTCAAGCATCCCGGAAAGTACCT

TTGGGCCCAACCCTTGCAGTTGCCTTCCTGACGCACAGAGCACAGACACAGAGCCCAGTGTCAGGAGGTCAAAGATAACCCTGCTTCTCTGGAGAAGCGT

GTGATCATATACAGTGTATGTACATGGAGGGAACAGCTGGTCAAAACTGGCTTCTTGATTCCCCAAGGGGAAAGACTGCCTTTGTAATGATCTTTTTTTC

CTTATTTATTTTACTTAAACTGGTTGAGTCTAAGCATTGTGTGAAGTGCCAGTGACTCTACCAGCAAGTCTTAGCATATTTTATTAGTTTGTCAGCTGAA

GTAGTCCTGTTGTTCGTTTCTGTTTTCAAGGTGAACTGAAAATTCTAGCTAAAATCACTAAGATAATCATGAGATGATTGCAAGATTGCAGTGAGCGGGG

TCAGTGCTGTCAGGAGGGACTGTCTCTCTCTGGCTGAGCATTTCCTCTTTGGTTATAGTTTGTCACTTTTTTTAAAGCTTTAATTTCAGTAAAGTAGGAA

TTCCCTGTTGCTAGAATGATAAAGGAAGCCGCAGCGTGAAGCCGGCATTCTTGCCAGCCAGAACCCCAGGACCGTGCACAGCTGCGGCGGTGGCATGGCG

TGTTCTTCCGGTCTCTTTTTAGCCTTGGGAAGGGCTAGTAGAGCAGCCAGAACCCCGGCAGCAGGGCAGCGCACGCCCTTTGGAAGATTACGTTTTGGTG

AAGTAGTAATCTCGAAAAGAAGCCCCTCCCTCCCCTCCCGACCTGATCGTCCTATTGGAGCAGTGTGTTCAGACGCTTACAACTAGGTCTGTTGGGAGTT

TAAGGAACAGTACGGGGAGTCTCCATGTCCCGCCAGGCATCAAGTGGTATGACAGTGGCTGAATGTAACTTGCAGAAAGTGGATGAGGATTCTAGTCGAA

GCTGTCAGACTCTGGGTAGCCTCACACTGCCCTCCGCATGCCGTGGTGGTGGTGGCCTGTTGATAAAGCCCCTGGTTTTCTATTTTACTAAAACTGTTGA

CTGAGAAGCAAACAGCAAAAAGAAATGTTTTTGTGCTGCTATGATTAACATTTATTTTCTACCTTTAGCTCAGGAAATGACTTCATCTATTCATCCCATA

GGCAGATTTGTGGCGGGGTCACTTAGCTAATCGGGCTTCGTGGACAGATGTGCTGGGAGAAAAAGATGGCCTTTGACAAACTCTTTCTGATAGTTTCTGA

AGCCTTACCCTGGCTGGGTTTGTGATCTGCCAGCATCGCACAGAGAACCACAACCAAGAGCATGGGAGGTAGAGCCAGGAGCACAGGCCTGCGAGGGCCT

ACGCCAGATTGTGTTGGAATTAAGACATGCCACGGCTGCAGCCTTGGGTTCAGAGACAAGGCATACAGTGCGGCTGGGTCCTCCAGGCGGCCTTGTGCAG

CACTGAATACTGTGTTTGCTTGCACACACATTTTTGAAGTTAAAACATAGCAGGAAAAACCTAGTTAAGTTCTCCATGAGGTGAGGTGTAGCATGGGAGC

CAACCTCCGGGCGAGCAGGCCTGCTTGGCTCAGGTCTGCGCTGGACGGTTTGCAGGGGAAGGGCTCCTGGGTGTTGGCTCCTAATTTACTTTTTATTTAT

AGTGCAGATGGATCTGAGGAAGACATTTTGAATTTTATCAGAGACTCAGTAAACTTAAAAAGCATACAGGGTTTGGGTTGGGGACTGGGGAAGGCAGGTA

TGGGGAGTGAGAAAGAAAGGTGACAAAGGTGACCCGCCCAGCACACACTTCAGGGGATTGTCGTTTGTTTGCCTGCGATTATGATGAGGGCAGATGCAAG

TTTCAGACAAGGCTAGCTGCTGTGTTATTATGTACATGTTTGCTTGGGCAGCTGTCCCAGATTTTGTATATTAGAACAAAAGTTTCTATGAATTAGCATA

ACTAAAAGTAAATATTGTAAGTGAAGCCCACTTCTGAGCCATGCGGCTTCTGTCATGGGGATTTCGCCTTTAGAAGGTTACTCAAGACAGGAGCCGAGTG

GCTTAGGCCGGGCCAGGAAATGTGCTATGGCGTCAGCCATCAGCATCGGGTTTTTCTTTCCATGATGGCCGTAGGAAGACCTCACTTTCATAACACGCTC

CTCCTGATACTTTGTGTAAAGATACTTTTCATTAAAGATTCTCTCAGGAGGGATGTGGCTGGGAGCTGGGAGGCAAGGTGCTGGAGTCCTCATTCTCCAG

TGAGCTTAGCTGTGTGACCTTGGGCAAGTCACCTAACCTCTCTGTGCTTCAGTCTCCCTCTTGTCAATGGGAGTAATACCTACCTCACAGGGTTGTTGTG

GGGATTAATTAGAGAGGAAGTCTGTAAAGCATTTAAAAGGTTCTTGAAGAAGGCGCTATATAAATACAAAATAATATCTATTAAAGTTGGCTTATTTGTG

CTTGTTGGTTTT
Translation
MEILMTVSKFASICTM - UNI17399 - GANASALEKEIGPEQFPVNEHYFGLVN - UNI16407 - - UNI31337 - - UNI37547 - FGN

TCYCNSVLQALYFCRPFREKVLAYKSQPRKKENLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENE - UNI22920 - - UNI31337 - - UN

I37547 - ELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLRNGDVDNEDNNSTPDPTWVHEIFQGTLTNETRCLTCET - UNI22920 - 

- UNI31337 - ISSKDEDFLDLSVDVEQNTSITHCLR RGFSNTETLCSEYKYYCEECRSKQEAHKR - UNI19857 - RMKVKKLPLILALHLKR

FKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMYDLVAVVVHCGS SGPNRGHYIAIVKSHDFWLLFDDDIVE KIDAQAIEEFYGLTSDISKNS

ESGYILFYQSRD
Transcript ENSMUST00000031645
Sequence
CCAGCGCGCTGGGCGGGGTGTGCTGTGAGCGGCTTCCCGGGCAGGCGCGGGCCCTGAGGCGGCGGCTGCGCCGTGCGCCGGGGCGGAGCCGGGGGCGGGC

GGGCGGCCGGCGGGCGGGGGCTGGGCCGGAGGAAGCCTGAGCGCCCGCGGCGACGACGGCAGCGGCGGCCCAGCAGGCTAGAAGCGTGGGTCGGCGGCGG

CTCCGGGTGCGGCCGCGGGCTGCGGAGCGAGCGGGCGGCCCGGCTCCCCGCGTCCCCCGCCCGCCGCGACTGTCTGGAAGATGGCGCCGGGCGGATGGAA

ATCCTAATGACAGTCTCCAAATTCGCCTCCATCTGTACCATG - UNI17399 - GGCGCCAATGCCTCGGCATTAGAGAAAGAGATTGGTCCAGAACA

GTTTCCGGTCAACGAGCACTATTTTGGATTAGTCAAT - UNI16407 - - UNI31337 - - UNI37547 - TTTGGGAATACCTGCTACTGCAA

CTCAGTTCTTCAAGCACTTTATTTTTGTCGTCCATTTCGGGAAAAAGTTCTAGCATACAAAAGTCAGCCCAGAAAAAAGGAGAACCTTCTCACCTGCCTG

GCAGACCTCTTCCACAGCATAGCCACCCAGAAGAAGAAGGTCGGCGTGATCCCGCCCAAGAAGTTCATCACAAGGTTGCGGAAAGAAAACG - UNI229

20 - - UNI31337 - - UNI37547 - AGCTGTTTGACAACTACATGCAACAAGATGCCCATGAATTCTTAAATTACCTACTCAATACAATTGCTG

ATATTCTACAAGAAGAAAGAAAACAGGAGAAGCAAAATGGCCGATTACGGAACGGAGACGTGGACAACGAGGATAACAACAGCACACCAGACCCAACCTG

GGTCCACGAGATCTTTCAGGGAACATTAACTAATGAAACCAGGTGTCTTACTTGTGAAACT - UNI22920 - - UNI31337 - ATAAGCAGCAAA

GATGAAGATTTTTTAGACCTTTCTGTTGACGTGGAACAAAACACATCAATTACTCACTGCTTAAG AGGGTTCAGTAACACAGAAACTCTGTGCAGTGAA

TATAAGTACTACTGTGAAGAGTGCCGGAGCAAGCAGGAAGCACACAAGCG - UNI19857 - GATGAAGGTTAAGAAACTGCCCCTGATCCTGGCTCT

GCACCTGAAGAGGTTTAAGTATATGGACCAGCTTCACCGGTACACGAAGCTTTCTTATCGCGTGGTCTTTCCTTTAGAGCTCCGTCTGTTCAACACGTCA

GGAGATGCGACCAACCCTGACAGAATGTATGACCTGGTCGCCGTTGTGGTTCAC - UNI19857 - TGGAAG TGGTCCCAACCGAGGCCATTATATT

GCAATAGTTAAGAGTCATGATTTCTGGCTGTTGTTTGATGATGACATTGTAGAA AAAATCGATGCCCAAGCTATTGAAGAATTCTACGGATTGACATCT

GACATCTCCAAGAACTCGGAGTCTGGCTACATCCTTTTCTATCAGTCTCGGGACTGAGAGGAGCCACGGTGGGGAGAAGCTTCTACAAGCTTCTCTGGTT

GTTTCAGAAAGGATCGAGCGGATGTTCAAGAAGAGAAAGCGAGACAGACAGACAGACAGCCACAGGACGCTCAGGGCAGTAGCTCACTTTGCATACGATA

AAGCAAAGACTGTGGATTAACATGCCCTTCCGGTTACAGTAGTTGAATTTTTTGCTCAGGAATCATGCTGTCTGTGCAGTTCACACAAGGAAGTAAAATC

AGAGATACCAGCTCTCGTGTAAAGCAGCTGCCAGCTGCCAACACATTTTCTGTAGTAATTGCACCAATGATGATTTGAGTTCCTCGGGAGGGCAGTGGAA

GAATTAGATGTGCTAGTCTGATTGAGCACACTGCACTGTGTGCCAGCGTGCGGGATGCGTACACTGTGCATGGGAGCAGTGGCGGTCTTGTCAAGCATCC

CGGAAAGTACCTTTGGGCCCAACCCTTGCAGTTGCCTTCCTGACGCACAGAGCACAGACACAGAGCCCAGTGTCAGGAGGTCAAAGATAACCCTGCTTCT

CTGGAGAAGCGTGTGATCATATACAGTGTATGTACATGGAGGGAACAGCTGGTCAAAACTGGCTTCTTGATTCCCCAAGGGGAAAGACTGCCTTTGTAAT

GATCTTTTTTTCCTTATTTATTTTACTTAAACTGGTTGAGTCTAAGCATTGTGTGAAGTGCCAGTGACTCTACCAGCAAGTCTTAGCATATTTTATTAGT

TTGTCAGCTGAAGTAGTCCTGTTGTTCGTTTCTGTTTTCAAGGTGAACTGAAAATTCTAGCTAAAATCACTAAGATAATCATGAGATGATTGCAAGATTG

CAGTGAGCGGGGTCAGTGCTGTCAGGAGGGACTGTCTCTCTCTGGCTGAGCATTTCCTCTTTGGTTATAGTTTGTCACTTTTTTTAAAGCTTTAATTTCA

GTAAAGTAGGAATTCCCTGTTGCTAGAATGATAAAGGAAGCCGCAGCGTGAAGCCGGCATTCTTGCCAGCCAGAACCCCAGGACCGTGCACAGCTGCGGC

GGTGGCATGGCGTGTTCTTCCGGTCTCTTTTTAGCCTTGGGAAGGGCTAGTAGAGCAGCCAGAACCCCGGCAGCAGGGCAGCGCACGCCCTTTGGAAGAT

TACGTTTTGGTGAAGTAGTAATCTCGAAAAGAAGCCCCTCCCTCCCCTCCCGACCTGATCGTCCTATTGGAGCAGTGTGTTCAGACGCTTACAACTAGGT

CTGTTGGGAGTTTAAGGAACAGTACGGGGAGTCTCCATGTCCCGCCAGGCATCAAGTGGTATGACAGTGGCTGAATGTAACTTGCAGAAAGTGGATGAGG

ATTCTAGTCGAAGCTGTCAGACTCTGGGTAGCCTCACACTGCCCTCCGCATGCCGTGGTGGTGGTGGCCTGTTGATAAAGCCCCTGGTTTTCTATTTTAC

TAAAACTGTTGACTGAGAAGCAAACAGCAAAAAGAAATGTTTTTGTGCTGCTATGATTAACATTTATTTTCTACCTTTAGCTCAGGAAATGACTTCATCT

ATTCATCCCATAGGCAGATTTGTGGCGGGGTCACTTAGCTAATCGGGCTTCGTGGACAGATGTGCTGGGAGAAAAAGATGGCCTTTGACAAACTCTTTCT

GATAGTTTCTGAAGCCTTACCCTGGCTGGGTTTGTGATCTGCCAGCATCGCACAGAGAACCACAACCAAGAGCATGGGAGGTAGAGCCAGGAGCACAGGC

CTGCGAGGGCCTACGCCAGATTGTGTTGGAATTAAGACATGCCACGGCTGCAGCCTTGGGTTCAGAGACAAGGCATACAGTGCGGCTGGGTCCTCCAGGC

GGCCTTGTGCAGCACTGAATACTGTGTTTGCTTGCACACACATTTTTGAAGTTAAAACATAGCAGGAAAAACCTAGTTAAGTTCTCCATGAGGTGAGGTG

TAGCATGGGAGCCAACCTCCGGGCGAGCAGGCCTGCTTGGCTCAGGTCTGCGCTGGACGGTTTGCAGGGGAAGGGCTCCTGGGTGTTGGCTCCTAATTTA

CTTTTTATTTATAGTGCAGATGGATCTGAGGAAGACATTTTGAATTTTATCAGAGACTCAGTAAACTTAAAAAGCATACAGGGTTTGGGTTGGGGACTGG

GGAAGGCAGGTATGGGGAGTGAGAAAGAAAGGTGACAAAGGTGACCCGCCCAGCACACACTTCAGGGGATTGTCGTTTGTTTGCCTGCGATTATGATGAG

GGCAGATGCAAGTTTCAGACAAGGCTAGCTGCTGTGTTATTATGTACATGTTTGCTTGGGCAGCTGTCCCAGATTTTGTATATTAGAACAAAAGTTTCTA

TGAATTAGCATAACTAAAAGTAAATATTGTAAGTGAAGCCCACTTCTGAGCCATGCGGCTTCTGTCATGGGGATTTCGCCTTTAGAAGGTTACTCAAGAC

AGGAGCCGAGTGGCTTAGGCCGGGCCAGGAAATGTGCTATGGCGTCAGCCATCAGCATCGGGTTTTTCTTTCCATGATGGCCGTAGGAAGACCTCACTTT

CATAACACGCTCCTCCTGATACTTTGTGTAAAGATACTTTTCATTAAAGATTCTCTCAGGAGGGATGTGGCTGGGAGCTGGGAGGCAAGGTGCTGGAGTC

CTCATTCTCCAGTGAGCTTAGCTGTGTGACCTTGGGCAAGTCACCTAACCTCTCTGTGCTTCAGTCTCCCTCTTGTCAATGGGAGTAATACCTACCTCAC

AGGGTTGTTGTGGGGATTAATTAGAGAGGAAGTCTGTAAAGCATTTAAAAGGTTCTTGAAGAAGGCGCTATATAAATACAAAATAATATCTATTAAAGTT

GGCTTATTTGTGCTTGTTGGTTTT
Translation
 - UNI17399 -  - UNI16407 - - UNI31337 - - UNI37547 -  - UNI22920 - - UNI31337 - - UNI37547 - MQQDAH

EFLNYLLNTIADILQEERKQEKQNGRLRNGDVDNEDNNSTPDPTWVHEIFQGTLTNETRCLTCET - UNI22920 - - UNI31337 - ISSKDEDF

LDLSVDVEQNTSITHCLR RGFSNTETLCSEYKYYCEECRSKQEAHKR - UNI19857 - RMKVKKLPLILALHLKRFKYMDQLHRYTKLSYRVVFPL

ELRLFNTSGDATNPDRMYDLVAVVVH - UNI19857 - WK WSQPRPLYCNS 

For any suggestions or comments, please send an email to unitrap@crg.es