Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029647 (Pan3)
Chromosomal location
Chr 5: 148242465 - 148360072 (+)
Description
PAN3 polyA specific ribonuclease subunit homolog (S. cerevisiae) Gene [Source:MGI Symbol;Acc:MGI:1919837]
RefSeq_dna
NM_028291 
RefSeq_peptide
NP_082567.2 
UniGene
Mm.320469 
MGI
MGI:1919837 
Uniprot/SWISSPROT
Q640Q5 
Uniprot/SPTREMBL
Q5U221 
Human Ortholog
ENSG00000152520 (PAN3)
Omim not available
UniTrap UNI6575
Vector Insertion
Chr 5: 148242586 - 148262228
Public Clones YHB182 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5649
Vector Insertion
Chr 5: 148299686 - 148299835
Public Clones CSI758 (baygenomics) XG307 (baygenomics) BGD641 (baygenomics) BGB533 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20540
Vector Insertion
Chr 5: 148299835 - 148314714
Public Clones not available
Private Clones OST359374 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27260
Vector Insertion
Chr 5: 148314779 - 148331080
Public Clones not available
Private Clones OST65480 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6015
Vector Insertion
Chr 5: 148338807 - 148341530
Public Clones CSH548 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000085571
Sequence
TTTCCTCCGGGAGCGCTCCCGGGCGGGGGAGCGGGGCCGCCCGCGGGGCCCAAGAAGCCGGAGCTGGGCGTCCCGGGGGCGGCGACCGCGGGCGGCGGAC

TCGATGGCCCGCGGGTGGCGA - UNI6575 - TTCCGGGAATGGATGGAGGTGCTTTAACTGATGCGAGTCTCACAGAGTCCTATTTCAGCACCAGCT

TTATTGGAGTCAATGGATTTGGAAGCCCTGTAGAAACAAAGTATCCCTTGATGCAG AGAATGACTAGTAGTAGCAGCTCCCCAAGCCTTCTAAATGACA

GTGCCAAGCCATACACAGGCCACG ATCTTCTGACTTCATCTGCTTCATCCTTGTTTAATGACTTCGGTGCCCTCAACATCTCCCAGAGAAGGAAG - U

NI5649 - ACACCAAATCCTACTGCAAGCGAATTTATACCTAAAGGAGGATCAACCTCCAGGCTGAGTAACGTGTCCCAGTCAAATATGTCTGCCTTCT

CTCAAGTTTTCTCTCACCCATCCATGGGAAGTCCTGCTACTGCTGGATTAGCACCAG - UNI5649 - - UNI20540 - - UNI27260 - GAAT

GTCACTGTCTGCTGGATCTTCCCCTCTCCATTCCCCCAAAATTACTCCACACACCTCTCCTGCTCCTAGAAGAAGAAGCCACACTCCAAACCCAGCAAGT

TTCATGGTGCCGCCTAGTGCCTCCACTCCTGCCAATAACCCTGCTCCTCAGCCTCCGTCCTCTGGTCAGGTGATCCAGAAGGAGACTGTCGGGGGGACGA

CTTACTTCTATACAGATACAACCCCAGCACCTTTGACTGGAATG GTATTTCCAAACTATCATATTTATCCTCCAACCGCACCTCATGTTGCTTATATGC

AACCAAAAGCAAATGCACCTTCCTTCTTCATGGCCGACGAGCTCCGACAG GAGCTGATCAACAGACATTTAATAACGATGGCTCAAATTGACCAAGCAG

ATATGCCAG CAGTCCCCACAGAAGTTGACAGCTACCATAGCCTGTTCCCTCTAGAACCACTGCCACCTCCCAACCGGATACAGAAATCAAGTAATTTTG

GATATATCACGTCTTGCTACAAAGCTGTAAATAGCAAAGATGATCTGCCATATTGCCTTCGGAGGATACATG GTTTTCGTCTTGTTAACACAAAGTGCA

TGGTGTTGGTTGATATGTGGAAAAAAATTCAGCACTCAAATATTGTAACTCTGCGTGAAGTGTTTACCACTAAAGCATTTGCCGAGCCTT CTCTGGTGT

TCGCCTATGATTTCCATGCTGGAGGAGAAACTATGATGAGCAGACACTTTAACGACCCGAATTCTGATGCCTACTTCACAAAGAGGAAGTGGG - UNI6

015 - GCCAGCACGATGGACCACTGCCCAGGCAGCATGCTGGATTGTTACCAGAGTCTCTCATCTGGGCATACATTGTACAGCTGAGTTCTGCTCTGCG

GACCATTCATACAGCAGGTTTGGCCTGTAGAGTAATGGACCCAACGAAGATTCTGATAACCAGCAAAACAAG GTTACGAGTAAATTGTGTAGGAGTCTT

TGATGTTTTAACATTTGATAACAGTCAAAATAATAATCCTTTGGCATTAATGGCTCAGTACCAG CAAGCAGATCTGATATCATTAGGAAAAGTTGTGTT

GGCTTTGGCTTGCAACTCTTTGGCAGGAATTCAGCGAGAAAATTTACAGAAAGCCATGGAATTGGTGACAATCAACTACTCCTCTGACCTGAAGAACCTC

ATCTT GTACTTGTTGACTGACCAAAACAGGATGCGGAGTGTGAATGACATCATGCCCATGATTGGTGCTCGGTTTTACACTCAATTGGATGCTGCTCAA

ATGAGAAATGATGTTATCGAGGAAGACCTTGCTAAG GAGGTTCAAAATGGAAGACTGTTTAGGCTTCTAGCAAAATTGGGAACAATCAACGAGAGGCCG

GA GTTTCAGAAGGATCCAACCTGGTCAGAGACTGGAGACAGATACCTGTTGAAACTCTTTAGAGATCATCTTTTTCATCAGGTGACAGAAGCAGGTGCT

CCCTGGATCGACCTCAGTCACATCATTTCTTGTCTTAACAAG CTAGATGCTGGTGTGCCAGAAAAAATCAGCCTGATTTCCAGAGACGAGAAGAGCGTG

CTGGTGGTGACATACAGTGACCTAAAACGCTGCTTTGAAAATACCTTTCAAGAACTGATTGCGGCTGCAAATG GTAACGATCGGAACAGTAACTGAAGG

AGCAGGCGCTGCTCTTCTCCAGGTTCATCTAGAGGCTTCTTCAAAGAGGCGTCTGTCTGCCAGTCACATACACTTATCTTGACGTAATTTTTAATAGCAA

AATGAAATTGTGCTGAAGGCCTAAAAGTGGAGGAGTTATATTACCTTAGGGTCTTTCCAGTTTATTTGTTTTTTGTTTTTTTTTTTGTTTTTGTTTTTTG

TTTTTTGTCTTTGAACTACAGCTTTATAATGGTACTTTACACTGGATAGACTCAGACACTGTCGAGGAGGTGAGCTGAGCACAGCAGTGGCCTGATGCTT

TGCGGCCTGACTCTGGAGGGACACTTTTCTGCTGTGCCTTTGCACTCACTGCTTAACCCAAAGGAACAGGACTTTTGATAAAACTCACCCTGTAGGGTCG

GTCATCTGAGAAGGCCATTTCAAAAGTTGGAGTTTTCCTCCATGGAACTTACTATTTGGACATGCAGTTGTCGCCAAACTCAAGTATTGTGGGATTTGTG

GTCACTTCGATACTGAAGACTGCCAAATACATTGGGATTTTCTCTTAAACAGCCGCCATGAAGACTTCATCTCCTTCCCGGTGCTGTGTGTTGAGCGCGC

ACTGGGTGTGCACCCCATACCTGGGAAGAAATGTGGGGATTTGGAGGTCAGGACAGACTCCAAGCACTTGCAACTGATGTTACTGTCTTCATTTTTAACA

AGTATGCGTATTTGTATATTTCAGAGAAGTTTTTAACATTTCTCTGTCCACTTTTTATAAGCTTTAAAATGATTTTTCTCTGCCTTGAAATTTGCATCAA

GAAAAAGCACCTCTCTTCACTGAAAGCTTTGAGGACTAGAGACACACTTCCCATGTCTAACAAGCACGTCTGTATCTGAGAGCGCTAGCATCAGTTGTTA

ATGAGAAAATCAATTACTGCATTTGATCTGGATGGATTTTAGAAGAACATAATGTTCAATATTCCAAGGATAATGAACATTTGCCACCATGATGTTCCTT

GTGTTTAAAGGGAACGAGAACTTTCGGTGTACCACGCAGAAGTCTTTATCATTAGCTCATGTATTTGAGGAAGAGCAGCTGTCTTTTTATATGTTTTTTG

ACAAATCATATTGTAATTCTTTTGTACAAAAAAGAACTACTTGTATTCTAGAAGAAATATGAAATGCTTAATTTATAAGCGGGCTGGAGATTTTTTTCCA

ATATTGTTTTCTTTGAAAATGAAAGGGGATCATCTATTTTAGTTTTGGGGGCCTGGGAACTTTTTGAAAATTTTCATTTGTGGACCAATGTTATGTGAAT

GCTAAGGAAGGGCAGGGGTAACATAGGGCTTGGACCTCTAGTCCTGCATAGACCAGCAAACTCCCCTCTGCAAGGCAGGTTCACATCACAACCCCGAGTG

TCTGCATCAGAAATGCTAGTCTGCTTCCGCCCCAGCAACCTCAGGACTTGGGTTGGGTATAAAAGGTAGTCAGCTGAAAGTACCTAAGTAAATAGTGTCA

GCCAGAAAACAGTCGGTGTCAGGTGATACGTATTTTTTAGCTTTGTTTTATATTTATTTTTCATTTCATTTTCATTGGGAATGGTTTTCAAAAGAACTCT

TGAGTTCTGCTTTGATGGGTTTCTTTTTTTTTTTTTTCTGTTTTGTTTTGCTTTGCTTTTTTTTTTTTTTTTTTTTTTTTCTGGGAGCCCTCTTTTCCAC

AGTGTAAACCCATATAGAAGGTTGTCTGAAAGTTACTATTTAGTGCATAGGAAGAGTTTAATATCTGAGAGTATCGAATGAAGGATGTGAACTCATCATA

ACTTCCTGTTATGACAGACACAACACGGAAAGGACAACCCTTGAAATCATGTCGCGTCGCTCACTTCAGCAGTGTACCCATCTCCAGTCCTGTTAGTGTA

TTCACTTCACTGCAGATACCTTTGAGGGTGCCCTTGTGTTCTGCTTTGACCTTGGTTCTGTCATTGGATAGCAACATTGTCTCTAGAAAGCACCAGTACG

TTTAAGTTCTAATGTCACAATCCCAGTACCTGTTGCTCATCTTTAACCCTGTTTTCAGTCTCTACGTGTATAGCAGTATTTTTTAATAAAGAATTGCAGA

AATAAA
Translation
 - UNI6575 - MDGGALTDASLTESYFSTSFIGVNGFGSPVETKYPLMQ RMTSSSSSPSLLNDSAKPYTGHD DLLTSSASSLFNDFGALNISQRRK

 - UNI5649 - TPNPTASEFIPKGGSTSRLSNVSQSNMSAFSQVFSHPSMGSPATAGLAPG - UNI5649 - - UNI20540 - - UNI27260 

- GMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNPASFMVPPSASTPANNPAPQPPSSGQVIQKETVGGTTYFYTDTTPAPLTGM VFPNYHIYPPTAPH

VAYMQPKANAPSFFMADELRQ ELINRHLITMAQIDQADMPA AVPTEVDSYHSLFPLEPLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYCLRRIHG G

FRLVNTKCMVLVDMWKKIQHSNIVTLREVFTTKAFAEPS SLVFAYDFHAGGETMMSRHFNDPNSDAYFTKRKWG - UNI6015 - GQHDGPLPRQHA

GLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKILITSKTR RLRVNCVGVFDVLTFDNSQNNNPLALMAQYQ QADLISLGKVVLALACNSLAGIQ

RENLQKAMELVTINYSSDLKNLIL LYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAK EVQNGRLFRLLAKLGTINERPE EFQKDPT

WSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLNK LDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANG GNDRNSN
Transcript ENSMUST00000110543
Sequence
ATGAAACAGACTGATTCGACTAAAGGATGGATAGTTTGGGCAGCGTTGGACAGCTCTATGAGGG - UNI27260 - GAATGTCACTGTCTGCTGGATC

TTCCCCTCTCCATTCCCCCAAAATTACTCCACACACCTCTCCTGCTCCTAGAAGAAGAAGCCACACTCCAAACCCAGCAAGTTTCATGGTGCCGCCTAGT

GCCTCCACTCCTGCCAATAACCCTGCTCCTCAGCCTCCGTCCTCTGGTCAGGTGATCCAGAAGGAGACTGTCGGGGGGACGACTTACTTCTATACAGATA

CAACCCCAGCACCTTTGACTGGAATG GTATTTCCAAACTATCATATTTATCCTCCAACCGCACCTCATGTTGCTTATATGCAACCAAAAGCAAATGCAC

CTTCCTTCTTCATGGCCGACGAGCTCCGACAG GAGCTGATCAACAGACATTTAATAACGATGGCTCAAATTGACCAAGCAGATATGCCAG CAGTCCCC

ACAGAAGTTGACAGCTACCATAGCCTGTTCCCTCTAGAACCACTGCCACCTCCCAACCGGATACAGAAATCAAGTAATTTTGGATATATCACGTCTTGCT

ACAAAGCTGTAAATAGCAAAGATGATCTGCCATATTGCCTTCGGAGGATACATG GTTTTCGTCTTGTTAACACAAAGTGCATGGTGTTGGTTGATATGT

GGAAAAAAATTCAGCACTCAAATATTGTAACTCTGCGTGAAGTGTTTACCACTAAAGCATTTGCCGAGCCTT CTCTGGTGTTCGCCTATGATTTCCATG

CTGGAGGAGAAACTATGATGAGCAGACACTTTAACGACCCGAATTCTGATGCCTACTTCACAAAGAGGAAGTGGG - UNI6015 - GCCAGCACGATG

GACCACTGCCCAGGCAGCATGCTGGATTGTTACCAGAGTCTCTCATCTGGGCATACATTGTACAGCTGAGTTCTGCTCTGCGGACCATTCATACAGCAGG

TTTGGCCTGTAGAGTAATGGACCCAACGAAGATTCTGATAACCAGCAAAACAAG GTTACGAGTAAATTGTGTAGGAGTCTTTGATGTTTTAACATTTGA

TAACAGTCAAAATAATAATCCTTTGGCATTAATGGCTCAGTACCAG CAAGCAGATCTGATATCATTAGGAAAAGTTGTGTTGGCTTTGGCTTGCAACTC

TTTGGCAGGAATTCAGCGAGAAAATTTACAGAAAGCCATGGAATTGGTGACAATCAACTACTCCTCTGACCTGAAGAACCTCATCTT GTACTTGTTGAC

TGACCAAAACAGGATGCGGAGTGTGAATGACATCATGCCCATGATTGGTGCTCGGTTTTACACTCAATTGGATGCTGCTCAAATGAGAAATGATGTTATC

GAGGAAGACCTTGCTAAG GAGGTTCAAAATGGAAGACTGTTTAGGCTTCTAGCAAAATTGGGAACAATCAACGAGAGGCCGGA GTTTCAGAAGGATCC

AACCTGGTCAGAGACTGGAGACAGATACCTGTTGAAACTCTTTAGAGATCATCTTTTTCATCAGGTGACAGAAGCAGGTGCTCCCTGGATCGACCTCAGT

CACATCATTTCTTGTCTTAACAAG CTAGATGCTGGTGTGCCAGAAAAAATCAGCCTGATTTCCAGAGACGAGAAGAGCGTGCTGGTGGTGACATACAGT

GACCTAAAACGCTGCTTTGAAAATACCTTTCAAGAACTGATTGCGGCTGCAAATG GTAACGATCGGAACAGTAACTGAAGGAGCAGGCGCTGCTCTTCT

CCAGGTTCATCTAGAGGCTTCTTCAAAGAGGCGTCTGTCTGCCAGTCACATACACTTATCTTGACGTAATTTTTAATAGCAAAATGAAATTGTGCTGAAG

GCCTAAAAGTGGAGGAGTTATATTACCTTAGGGTCTTTCCAGTTTATTTGTTTTTTGTTTTTTTTTTTGTTTTTGTTTTTTGTTTTTTGTCTTTGAACTA

CAGCTTTATAATGGTACTTTACACTGGATAGACTCAGACACTGTCGAGGAGGTGAGCTGAGCACAGCAGTGGCCTGATGCTTTGCGGCCTGACTCTGGAG

GGACACTTTTCTGCTGTGCCTTTGCACTCACTGCTTAACCCAAAGGAACAGGACTTTTGATAAAACTCACCCTGTAGGGTCGGTCATCTGAGAAGGCCAT

TTCAAAAGTTGGAGTTTTCCTCCATGGAACTTACTATTTGGACATGCAGTTGTCGCCAAACTCAAGTATTGTGGGATTTGTGGTCACTTCGATACTGAAG

ACTGCCAAATACATTGGGATTTTCTCTTAAACAGCCGCCATGAAGACTTCATCTCCTTCCCGGTGCTGTGTGTTGAGCGCGCACTGGGTGTGCACCCCAT

ACCTGGGAAGAAATGTGGGGATTTGGAGGTCAGGACAGACTCCAAGCACTTGCAACTGATGTTACTGTCTTCATTTTTAACAAGTATGCGTATTTGTATA

TTTCAGAGAAGTTTTTAACATTTCTCTGTCCACTTTTTATAAGCTTTAAAATGATTTTTCTCTGCCTTGAAATTTGCATCAAGAAAAAGCACCTCTCTTC

ACTGAAAGCTTTGAGGACTAGAGACACACTTCCCATGTCTAACAAGCACGTCTGTATCTGAGAGCGCTAGCATCAGTTGTTAATGAGAAAATCAATTACT

GCATTTGATCTGGATGGATTTTAGAAGAACATAATGTTCAATATTCCAAGGATAATGAACATTTGCCACCATGATGTTCCTTGTGTTTAAAGGGAACGAG

AACTTTCGGTGTACCACGCAGAAGTCTTTATCATTAGCTCATGTATTTGAGGAAGAGCAGCTGTCTTTTTATATGTTTTTTGACAAATCATATTGTAATT

CTTTTGTACAAAAAAGAACTACTTGTATTCTAGAAGAAATATGAAATGCTTAATTTATAAGCGGGCTGGAGATTTTTTTCCAATATTGTTTTCTTTGAAA

ATGAAAGGGGATCATCTATTTTAGTTTTGGGGGCCTGGGAACTTTTTGAAAATTTTCATTTGTGGACCAATGTTATGTGAATGCTAAGGAAGGGCAGGGG

TAACATAGGGCTTGGACCTCTAGTCCTGCATAGACCAGCAAACTCCCCTCTGCAAGGCAGGTTCACATCACAACCCCGAGTGTCTGCATCAGAAATGCTA

GTCTGCTTCCGCCCCAGCAACCTCAGGACTTGGGTTGGGTATAAAAGGTAGTCAGCTGAAAGTACCTAAGTAAATAGTGTCAGCCAGAAAACAGTCGGTG

TCAGGTGATACGTATTTTTTAGCTTTGTTTTATATTTATTTTTCATTTCATTTTCATTGGGAATGGTTTTCAAAAGAACTCTTGAGTTCTGCTTTGATGG

GTTTCTTTTTTTTTTTTTTCTGTTTTGTTTTGCTTTGCTTTTTTTTTTTTTTTTTTTTTTTTCTGGGAGCCCTCTTTTCCACAGTGTAAACCCATATAGA

AGGTTGTCTGAAAGTTACTATTTAGTGCATAGGAAGAGTTTAATATCTGAGAGTATCGAATGAAGGATGTGAACTCATCATAACTTCCTGTTATGACAGA

CACAACACGGAAAGGACAACCCTTGAAATCATGTCGCGTCGCTCACTTCAGCAGTGTACCCATCTCCAGTCCTGTTAGTGTATTCACTTCACTGCAGATA

CCTTTGAGGGTGCCCTTGTGTTCTGCTTTGACCTTGGTTCTGTCATTGGATAGCAACATTGTCTCTAGAAAGCACCAGTACGTTTAAGTTCTAATGTCAC

AATCCCAGTACCTGTTGCTCATCTTTAACCCTGTTTTCAGTCTCTACGTGTATAGCAGTATTTTTTAATAAAGAATTGCAGAAATAAA
Translation
MKQTDSTKGWIVWAALDSSMRG - UNI27260 - GMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNPASFMVPPSASTPANNPAPQPPSSGQVIQKET

VGGTTYFYTDTTPAPLTGM VFPNYHIYPPTAPHVAYMQPKANAPSFFMADELRQ ELINRHLITMAQIDQADMPA AVPTEVDSYHSLFPLEPLPPPNR

IQKSSNFGYITSCYKAVNSKDDLPYCLRRIHG GFRLVNTKCMVLVDMWKKIQHSNIVTLREVFTTKAFAEPS SLVFAYDFHAGGETMMSRHFNDPNSD

AYFTKRKWG - UNI6015 - GQHDGPLPRQHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKILITSKTR RLRVNCVGVFDVLTFDNSQNN

NPLALMAQYQ QADLISLGKVVLALACNSLAGIQRENLQKAMELVTINYSSDLKNLIL LYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEED

LAK EVQNGRLFRLLAKLGTINERPE EFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLNK LDAGVPEKISLISRDEKSVLVVTYS

DLKRCFENTFQELIAAANG GNDRNSN
Transcript ENSMUST00000031651
Sequence
TTTCCTCCGGGAGCGCTCCCGGGCGGGGGAGCGGGGCCGCCCGCGGGGCCCAAGAAGCCGGAGCTGGGCGTCCCGGGGGCGGCGACCGCGGGCGGCGGAC

TCGATGGCCCGCGGGTGGCGA - UNI6575 - TTCCGGGAATGGATGGAGGTGCTTTAACTGATGCGAGTCTCACAGAGTCCTATTTCAGCACCAGCT

TTATTGGAGTCAATGGATTTGGAAGCCCTGTAGAAACAAAGTATCCCTTGATGCAG AGAATGACTAGTAGTAGCAGCTCCCCAAGCCTTCTAAATGACA

GTGCCAAGCCATACACAGGCCACG ATCTTCTGACTTCATCTGCTTCATCCTTGTTTAATGACTTCGGTGCCCTCAACATCTCCCAGAGAAGGAAG - U

NI5649 - ACACCAAATCCTACTGCAAGCGAATTTATACCTAAAGGAGGATCAACCTCCAGGCTGAGTAACGTGTCCCAGTCAAATATGTCTGCCTTCT

CTCAAGTTTTCTCTCACCCATCCATGGGAAGTCCTGCTACTGCTGGATTAGCACCAG - UNI5649 - - UNI20540 - - UNI27260 - GAAT

GTCACTGTCTGCTGGATCTTCCCCTCTCCATTCCCCCAAAATTACTCCACACACCTCTCCTGCTCCTAGAAGAAGAAGCCACACTCCAAACCCAGCAAGT

TTCATGGTGCCGCCTAGTGCCTCCACTCCTGCCAATAACCCTGCTCCTCAGCCTCCGTCCTCTGGTCAGGTGATCCAGAAGGAGACTGTCGGGGGGACGA

CTTACTTCTATACAGATACAACCCCAGCACCTTTGACTGGAATG GTATTTCCAAACTATCATATTTATCCTCCAACCGCACCTCATGTTGCTTATATGC

AACCAAAAGCAAATGCACCTTCCTTCTTCATGGCCGACGAGCTCCGACAG GAGCTGATCAACAGACATTTAATAACGATGGCTCAAATTGACCAAGCAG

ATATGCCAG CAGTCCCCACAGAAGTTGACAGCTACCATAGCCTGTTCCCTCTAGAACCACTGCCACCTCCCAACCGGATACAGAAATCAAGTAATTTTG

GATATATCACGTCTTGCTACAAAGCTGTAAATAGCAAAGATGATCTGCCATATTGCCTTCGGAGGATACATG CTCTGGTGTTCGCCTATGATTTCCATG

CTGGAGGAGAAACTATGATGAGCAGACACTTTAACGACCCGAATTCTGATGCCTACTTCACAAAGAGGAAGTGGG - UNI6015 - GCCAGCACGATG

GACCACTGCCCAGGCAGCATGCTGGATTGTTACCAGAGTCTCTCATCTGGGCATACATTGTACAGCTGAGTTCTGCTCTGCGGACCATTCATACAGCAGG

TTTGGCCTGTAGAGTAATGGACCCAACGAAGATTCTGATAACCAGCAAAACAAG GTTACGAGTAAATTGTGTAGGAGTCTTTGATGTTTTAACATTTGA

TAACAGTCAAAATAATAATCCTTTGGCATTAATGGCTCAGTACCAG CAAGCAGATCTGATATCATTAGGAAAAGTTGTGTTGGCTTTGGCTTGCAACTC

TTTGGCAGGAATTCAGCGAGAAAATTTACAGAAAGCCATGGAATTGGTGACAATCAACTACTCCTCTGACCTGAAGAACCTCATCTT GTACTTGTTGAC

TGACCAAAACAGGATGCGGAGTGTGAATGACATCATGCCCATGATTGGTGCTCGGTTTTACACTCAATTGGATGCTGCTCAAATGAGAAATGATGTTATC

GAGGAAGACCTTGCTAAG GAGGTTCAAAATGGAAGACTGTTTAGGCTTCTAGCAAAATTGGGAACAATCAACGAGAGGCCGGA GTTTCAGAAGGATCC

AACCTGGTCAGAGACTGGAGACAGATACCTGTTGAAACTCTTTAGAGATCATCTTTTTCATCAGGTGACAGAAGCAGGTGCTCCCTGGATCGACCTCAGT

CACATCATTTCTTGTCTTAACAAG CTAGATGCTGGTGTGCCAGAAAAAATCAGCCTGATTTCCAGAGACGAGAAGAGCGTGCTGGTGGTGACATACAGT

GACCTAAAACGCTGCTTTGAAAATACCTTTCAAGAACTGATTGCGGCTGCAAATG GTAACGATCGGAACAGTAACTGAAGGAGCAGGCGCTGCTCTTCT

CCAGGTTCATCTAGAGGCTTCTTCAAAGAGGCGTCTGTCTGCCAGTCACATACACTTATCTTGACGTAATTTTTAATAGCAAAATGAAATTGTGCTGAAG

GCCTAAAAGTGGAGGAGTTATATTACCTTAGGGTCTTTCCAGTTTATTTGTTTTTTGTTTTTTTTTTTGTTTTTGTTTTTTGTTTTTTGTCTTTGAACTA

CAGCTTTATAATGGTACTTTACACTGGATAGACTCAGACACTGTCGAGGAGGTGAGCTGAGCACAGCAGTGGCCTGATGCTTTGCGGCCTGACTCTGGAG

GGACACTTTTCTGCTGTGCCTTTGCACTCACTGCTTAACCCAAAGGAACAGGACTTTTGATAAAACTCACCCTGTAGGGTCGGTCATCTGAGAAGGCCAT

TTCAAAAGTTGGAGTTTTCCTCCATGGAACTTACTATTTGGACATGCAGTTGTCGCCAAACTCAAGTATTGTGGGATTTGTGGTCACTTCGATACTGAAG

ACTGCCAAATACATTGGGATTTTCTCTTAAACAGCCGCCATGAAGACTTCATCTCCTTCCCGGTGCTGTGTGTTGAGCGCGCACTGGGTGTGCACCCCAT

ACCTGGGAAGAAATGTGGGGATTTGGAGGTCAGGACAGACTCCAAGCACTTGCAACTGATGTTACTGTCTTCATTTTTAACAAGTATGCGTATTTGTATA

TTTCAGAGAAGTTTTTAACATTTCTCTGTCCACTTTTTATAAGCTTTAAAATGATTTTTCTCTGCCTTGAAATTTGCATCAAGAAAAAGCACCTCTCTTC

ACTGAAAGCTTTGAGGACTAGAGACACACTTCCCATGTCTAACAAGCACGTCTGTATCTGAGAGCGCTAGCATCAGTTGTTAATGAGAAAATCAATTACT

GCATTTGATCTGGATGGATTTTAGAAGAACATAATGTTCAATATTCCAAGGATAATGAACATTTGCCACCATGATGTTCCTTGTGTTTAAAGGGAACGAG

AACTTTCGGTGTACCACGCAGAAGTCTTTATCATTAGCTCATGTATTTGAGGAAGAGCAGCTGTCTTTTTATATGTTTTTTGACAAATCATATTGTAATT

CTTTTGTACAAAAAAGAACTACTTGTATTCTAGAAGAAATATGAAATGCTTAATTTATAAGCGGGCTGGAGATTTTTTTCCAATATTGTTTTCTTTGAAA

ATGAAAGGGGATCATCTATTTTAGTTTTGGGGGCCTGGGAACTTTTTGAAAATTTTCATTTGTGGACCAATGTTATGTGAATGCTAAGGAAGGGCAGGGG

TAACATAGGGCTTGGACCTCTAGTCCTGCATAGACCAGCAAACTCCCCTCTGCAAGGCAGGTTCACATCACAACCCCGAGTGTCTGCATCAGAAATGCTA

GTCTGCTTCCGCCCCAGCAACCTCAGGACTTGGGTTGGGTATAAAAGGTAGTCAGCTGAAAGTACCTAAGTAAATAGTGTCAGCCAGAAAACAGTCGGTG

TCAGGTGATACGTATTTTTTAGCTTTGTTTTATATTTATTTTTCATTTCATTTTCATTGGGAATGGTTTTCAAAAGAACTCTTGAGTTCTGCTTTGATGG

GTTTCTTTTTTTTTTTTTTCTGTTTTGTTTTGCTTTGCTTTTTTTTTTTTTTTTTTTTTTTTCTGGGAGCCCTCTTTTCCACAGTGTAAACCCATATAGA

AGGTTGTCTGAAAGTTACTATTTAGTGCATAGGAAGAGTTTAATATCTGAGAGTATCGAATGAAGGATGTGAACTCATCATAACTTCCTGTTATGACAGA

CACAACACGGAAAGGACAACCCTTGAAATCATGTCGCGTCGCTCACTTCAGCAGTGTACCCATCTCCAGTCCTGTTAGTGTATTCACTTCACTGCAGATA

CCTTTGAGGGTGCCCTTGTGTTCTGCTTTGACCTTGGTTCTGTCATTGGATAGCAACATTGTCTCTAGAAAGCACCAGTACGTTTAAGTTCTAATGTCAC

AATCCCAGTACCTGTTGCTCATCTTTAACCCTGTTTTCAGTCTCTACGTGTATAGCAGTATTTTTTAATAAAGAATTGCAGAAATAAA
Translation
 - UNI6575 -    - UNI5649 -  - UNI5649 - - UNI20540 - - UNI27260 -  MADELRQ ELINRHLITMAQIDQADMPA AVP

TEVDSYHSLFPLEPLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYCLRRIHA ALVFAYDFHAGGETMMSRHFNDPNSDAYFTKRKWG - UNI6015 -

 GQHDGPLPRQHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKILITSKTR RLRVNCVGVFDVLTFDNSQNNNPLALMAQYQ QADLISLGKV

VLALACNSLAGIQRENLQKAMELVTINYSSDLKNLIL LYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAK EVQNGRLFRLLAKLGTI

NERPE EFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLNK LDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANG G

NDRNSN

For any suggestions or comments, please send an email to unitrap@crg.es