Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029657 (Hsph1)
Chromosomal location
Chr 5: 150416862 - 150438913 (-)
Description
heat shock 105kDa/110kDa protein 1 Gene [Source:MGI (curated);Acc:Hsph1-006]
RefSeq_dna
NM_013559 
RefSeq_peptide
NP_038587.2 
UniGene
Mm.385229 
MGI
MGI:105053 
Uniprot/SWISSPROT
Q61699 
Uniprot/SPTREMBL
Q8C6H1 
Human Ortholog
ENSG00000120694 (HSPH1)
Omim not available
UniTrap UNI12189
Vector Insertion
Chr 5: 150438544 - 150438809
Public Clones W242F03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38414
Vector Insertion
Chr 5: 150436404 - 150438747
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15106
Vector Insertion
Chr 5: 150427543 - 150429964
Public Clones PST13286-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2679
Vector Insertion
Chr 5: 150423259 - 150426039
Public Clones AL0516 (sanger) AE0073 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2614
Vector Insertion
Chr 5: 150421644 - 150422451
Public Clones XR0804 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000074846
Sequence
AGCTGAGCGGCGGCGGCTGCGTGAGAGAGGCGGGCGGCGGAGAGCGGTGGCAGAGACTGAGCGCAGTCTTGCAGGGTAAGCCGGAGGCATCTTCCCGACT

GGTCGGGAGCAGGACGAGCACGCAGCGGACCCGAGGCGGAGGCGGACCGGGCCAGCCATGTCGGTGGTTGGGCTAGACGTAGGCTCACAGAGCTGCTACA

TTGCGGTGGCGCGGGCCGGGGGCATCGAGACCATCGCCAACGAGTTCAGCGACCGCTGCACCCC - UNI12189 - GTCAGTCATATCATTTGGATCA

AAAAACAGAACAATTGGAGTTGCAGCCAAAAACCAG CAAATCACTCATGCAAACAATACGGTCTCTAGCTTTAAGAGATTTCATGGCAGAGCATTCAAT

GACCCCTTCATTCAGAAGGAAAAGGAGAACCTGAGCTATGATTTGGTCCCAATGAAAAATGGTGGCGTGGGAATAAAG GTCATGTACATGGATGAAGAA

CATTTCTTCAGTGTGGAGCAGATAACAGCCATGCTGCTGACTAAGTTAAAGGAAACTGCAGAAAACAACCTCAAGAAGCCAGTGACAGACTGTGTCATCT

CA GTCCCATCCTTCTTCACAGATGCTGAGCGAAGGTCTGTGCTGGATGCTGCGCAGATTGTGGGCTTGAACTGCTTGCGGCTCATGAATGACATGACGG

CTG TTGCTTTGAATTATGGGATTTATAAGCAAGATCTCCCGAATGCCGAGGAGAAGCCACGGGTGGTGGTGTTTGTTGACATGGGACACTCATCTTTCC

AAGTGTCTGCCTGTGCTTTTAACAAAGGAAAACTGAAG GTTCTAGGCACAGCTTTTGATCCCTTCTTAGGAGGAAAGAACTTTGATGAGAAGCTAGTAG

AACATTTTTGTGCTGAATTTAAAACCAAGTACAAATTGGATGCAAAATCCAAAATTCGAGCCCTCCTTCGTCTCCATCAGGAGTGTGAAAAGTTGAAAAA

GCTCATGAGTTCTAACAGCACGGACCTGCCGCTGAACATCGAGTGCTTTATGAATGACAAGGATGTCTCTGGGAAGATGAACAG GTCACAGTTTGAAGA

ACTGTGTGCTGAGCTCCTGCAAAAAATAGAGGTCCCCCTTCACTCGTTGATGGCACAGACTCAGCTCAAGGCTGAAGATGTGAGTGCCATTGAGATAGTG

GGAGGTGCCACAAGAATCCCAGCTGTGAAAGAAAGAATTGCCAAGTTCTTTGGAAAAGATGTCAGCACCACGCTCAATGCAGACGAAGCTGTGGCCAGAG

GCTGTGCACTGCAG TGTGCAATTCTTTCTCCGGCATTTAAAGTTAGAGAGTTCTCTGTCACCGATGCAGTTCCTTTTCCAATATCTCTGGTCTGGAACC

ACGACTCGGAAGAAACGGAAGG - UNI15106 - TGTGCACGAGGTGTTCAGTCGGAACCATGCTGCTCCTTTCTCCAAAGTGCTCACCTTCCTGAGA

AGGGGGCCCTTTGAGCTAGAAGCTTTCTATTCTGACCCTCAAGGAGTTCCATATCCAGAAGCAAAAATAG - UNI15106 - GCCGTTTTGTTGTTCA

GAATGTTTCTGCACAGAAAGATGGAGAGAAGTCGAGAGTGAAGGTCAAAGTGCGTGTGAACACACATGGCATCTTCACCATCTCCACGGCTTCCATGGTG

GAGAAGGTCCCGACCGAGGAAGAGGATGGCTCCTCTCTCGAGGCAGACATGGAATGTCCAAACCAGAGGCCAACAGAAAGCTCGGATGTGGAT - UNI1

5106 - AAAAATATCCAGCAAGACAACAGTGAAGCTGGAACACAGCCCCAGGTACAAACTGATGGTCAACAAACCTCACAGTCTCCCCCTTCACCTGAA

CTTACCTCAGAAGAAAGCAAAACCCCAGATGCTGACAAA - UNI2679 - GCAAATGAAAAGAAAGTTGATCAGCCTCCAGAAGCCAAGAAACCTAAA

ATAAAGGTGGTAAATGTTGAGCTGCCTGTAGAAGCCAACTTGGTATGGCAGTTAGGGAGAGACCTTCTTAACATGTATATTGAGACAGAG GGCAAGATG

ATCATGCAAGACAAGCTGGAGAAGGAGCGGAACGACGCCAAGAACGCCGTGGAGGAGTGTGTATATGAGTTCAGGGACAAGCTATGTGGACCATATGAGA

AATTCATATGTGAGCAG - UNI2614 - GAACATGAGAAGTTCTTGAGGCTTCTAACAGAGACGGAAGACTGGCTGTATGAGGAAGGGGAGGACCAGG

CTAAGCAGGCATACATTGACAAGTTGGAAGAGCTGATG AAAATGGGCACTCCTGTTAAAGTCAGATTTCAAGAAGCTGAGGAACGACCGAAAGTGTTGG

AGGAGCTGGGGCAGCGCCTGCAGCACTATGCCAAGATTGCAGCGGACTTCAGAGGCAAG GATGAGAAATACAACCACATTGATGAATCAGAAATGAAGA

AGGTTGAGAAGTCTGTTAATGAGGTGATGGAGTGGATGAATAATGTCATGAATGCTCAGGCTAAAAGAAGTCTTGATCAAGACCCTGTTGTTCGAACTCA

TGAAATCAGAGCGAAGGTCAAG GAATTGAACAATGTTTGTGAACCTGTTGTAACTCAACCCAAACCAAAAATCGAGTCACCTAAACTGGAGAGAACTCC

AAATGGCCCAAATATTGACAAGAAAGAAGATTTAGAAGGCAAAAATAATCTTGGTGCTGAAGCTCCGCATCAGAATGGTGAATGCCACCCTAATGAGAAG

GGCTCTGTCAACATGGACCTGGACTAGGCTCTGTGCTGGCTCCCTCCCCCACTTCATGAGATGTGTTTGCCATAGTATGTGATCCTGTATAACAGACTGA

GTCTATTTATATTTTCTTTTTTTTAAGACTGTCTAGAAATTTTGTGTATTATGAGGGGAAAAAAGGAAAAGCTTGAATCTGTGTAGTCTCTGACCCTAAG

TGAGAATGACTTTGGTGTCAGGGTCCTGTGGAGTTGTGCCCCACACTGAGCTCTGTACAGTATTGCTGCTCATACACTGAGGAGGTGGGGTCGTCTTCTG

AGGATATGAACTACACTGCTTGGTCACACGCTGGGATCAGAATCTTAAGCAGTTATTCTTGCCAAGGGTTTTGTTTTGTTTTGCATTTTGCTCTTCATTT

CCGCATGTGTGTGGCTGTGGTTGTTTATAAATGAGACTAAGTCTGATTTGCATAAGGGCTTTCAAAAATTAAGTCTGTCCAGTAGAGTGATTTTGCTTTC

ATTATTACCAAGTCAAGAGTACAACAGAGCTAGTGAACCGTAGCAGCATGCGAAGCAGGGCTGTGAACTATCACCACACAGTGCATTGTCCCGTGGAGGT

GTGACACGGGAGACACACGTGTGGATCATGTGATCATTGTGAACACCTCGTGAGCTTTAAAATAAAGTCCACCCTGTGGTGTCATTTCT
Translation
MSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTP - UNI12189 - PSVISFGSKNRTIGVAAKNQ QITHANNTVSSFKRFHGRAFNDPFIQKEK

ENLSYDLVPMKNGGVGIK VMYMDEEHFFSVEQITAMLLTKLKETAENNLKKPVTDCVIS VPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAV VALN

YGIYKQDLPNAEEKPRVVVFVDMGHSSFQVSACAFNKGKLK VLGTAFDPFLGGKNFDEKLVEHFCAEFKTKYKLDAKSKIRALLRLHQECEKLKKLMSS

NSTDLPLNIECFMNDKDVSGKMNR RSQFEELCAELLQKIEVPLHSLMAQTQLKAEDVSAIEIVGGATRIPAVKERIAKFFGKDVSTTLNADEAVARGCA

LQ CAILSPAFKVREFSVTDAVPFPISLVWNHDSEETEG - UNI15106 - GVHEVFSRNHAAPFSKVLTFLRRGPFELEAFYSDPQGVPYPEAKIG 

- UNI15106 - GRFVVQNVSAQKDGEKSRVKVKVRVNTHGIFTISTASMVEKVPTEEEDGSSLEADMECPNQRPTESSDVD - UNI15106 - KNI

QQDNSEAGTQPQVQTDGQQTSQSPPSPELTSEESKTPDADK - UNI2679 - ANEKKVDQPPEAKKPKIKVVNVELPVEANLVWQLGRDLLNMYIETE

 GKMIMQDKLEKERNDAKNAVEECVYEFRDKLCGPYEKFICEQ - UNI2614 - EHEKFLRLLTETEDWLYEEGEDQAKQAYIDKLEELM KMGTPVK

VRFQEAEERPKVLEELGQRLQHYAKIAADFRGK DEKYNHIDESEMKKVEKSVNEVMEWMNNVMNAQAKRSLDQDPVVRTHEIRAKVK ELNNVCEPVVT

QPKPKIESPKLERTPNGPNIDKKEDLEGKNNLGAEAPHQNGECHPNEKGSVNMDLD
Transcript ENSMUST00000110499
Sequence
AGCTGAGCGGCGGCGGCTGCGTGAGAGAGGCGGGCGGCGGAGAGCGGTGGCAGAGACTGAGCGCAGTCTTGCAGGGTAAGCCGGAGGCATCTTCCCGACT

GGTCGGGAGCAGGACGAGCACGCAGCGGACCCGAGGCGGAGGCGGACCGGGCCAGCCATGTCGGTGGTTGGGCTAGACGTAGGCTCACAGAGCTGCTACA

TTGCGGTGGCGCGGGCCGGGGGCATCGAGACCATCGCCAACGAGTTCAGCGACCGCTGCACCCC - UNI12189 - GTCAGTCATATCATTTGGATCA

AAAAACAGAACAATTGGAGTTGCAGCCAAAAACCAG CAAATCACTCATGCAAACAATACGGTCTCTAGCTTTAAGAGATTTCATGGCAGAGCATTCAAT

GACCCCTTCATTCAGAAGGAAAAGGAGAACCTGAGCTATGATTTGGTCCCAATGAAAAATGGTGGCGTGGGAATAAAG GTCATGTACATGGATGAAGAA

CATTTCTTCAGTGTGGAGCAGATAACAGCCATGCTGCTGACTAAGTTAAAGGAAACTGCAGAAAACAACCTCAAGAAGCCAGTGACAGACTGTGTCATCT

CA GTCCCATCCTTCTTCACAGATGCTGAGCGAAGGTCTGTGCTGGATGCTGCGCAGATTGTGGGCTTGAACTGCTTGCGGCTCATGAATGACATGACGG

CTG TTGCTTTGAATTATGGGATTTATAAGCAAGATCTCCCGAATGCCGAGGAGAAGCCACGGGTGGTGGTGTTTGTTGACATGGGACACTCATCTTTCC

AAGTGTCTGCCTGTGCTTTTAACAAAGGAAAACTGAAG GTTCTAGGCACAGCTTTTGATCCCTTCTTAGGAGGAAAGAACTTTGATGAGAAGCTAGTAG

AACATTTTTGTGCTGAATTTAAAACCAAGTACAAATTGGATGCAAAATCCAAAATTCGAGCCCTCCTTCGTCTCCATCAGGAGTGTGAAAAGTTGAAAAA

GCTCATGAGTTCTAACAGCACGGACCTGCCGCTGAACATCGAGTGCTTTATGAATGACAAGGATGTCTCTGGGAAGATGAACAG GTCACAGTTTGAAGA

ACTGTGTGCTGAGCTCCTGCAAAAAATAGAGGTCCCCCTTCACTCGTTGATGGCACAGACTCAGCTCAAGGCTGAAGATGTGAGTGCCATTGAGATAGTG

GGAGGTGCCACAAGAATCCCAGCTGTGAAAGAAAGAATTGCCAAGTTCTTTGGAAAAGATGTCAGCACCACGCTCAATGCAGACGAAGCTGTGGCCAGAG

GCTGTGCACTGCAG TGTGCAATTCTTTCTCCGGCATTTAAAGTTAGAGAGTTCTCTGTCACCGATGCAGTTCCTTTTCCAATATCTCTGGTCTGGAACC

ACGACTCGGAAGAAACGGAAGG - UNI15106 - TGTGCACGAGGTGTTCAGTCGGAACCATGCTGCTCCTTTCTCCAAAGTGCTCACCTTCCTGAGA

AGGGGGCCCTTTGAGCTAGAAGCTTTCTATTCTGACCCTCAAGGAGTTCCATATCCAGAAGCAAAAATAG - UNI15106 - GCCGTTTTGTTGTTCA

GAATGTTTCTGCACAGAAAGATGGAGAGAAGTCGAGAGTGAAGGTCAAAGTGCGTGTGAACACACATGGCATCTTCACCATCTCCACGGCTTCCATGGTG

GAGAAGGTCCCGACCGAGGAAGAGGATGGCTCCTCTCTCGAGGCAGACATGGAATGTCCAAACCAGAGGCCAACAGAAAGCTCGGATGTGGAT - UNI2

679 - - UNI15106 - GCAAATGAAAAGAAAGTTGATCAGCCTCCAGAAGCCAAGAAACCTAAAATAAAGGTGGTAAATGTTGAGCTGCCTGTAGAA

GCCAACTTGGTATGGCAGTTAGGGAGAGACCTTCTTAACATGTATATTGAGACAGAG GGCAAGATGATCATGCAAGACAAGCTGGAGAAGGAGCGGAAC

GACGCCAAGAACGCCGTGGAGGAGTGTGTATATGAGTTCAGGGACAAGCTATGTGGACCATATGAGAAATTCATATGTGAGCAG - UNI2614 - GAA

CATGAGAAGTTCTTGAGGCTTCTAACAGAGACGGAAGACTGGCTGTATGAGGAAGGGGAGGACCAGGCTAAGCAGGCATACATTGACAAGTTGGAAGAGC

TGATG AAAATGGGCACTCCTGTTAAAGTCAGATTTCAAGAAGCTGAGGAACGACCGAAAGTGTTGGAGGAGCTGGGGCAGCGCCTGCAGCACTATGCCA

AGATTGCAGCGGACTTCAGAGGCAAG GATGAGAAATACAACCACATTGATGAATCAGAAATGAAGAAGGTTGAGAAGTCTGTTAATGAGGTGATGGAGT

GGATGAATAATGTCATGAATGCTCAGGCTAAAAGAAGTCTTGATCAAGACCCTGTTGTTCGAACTCATGAAATCAGAGCGAAGGTCAAG GAATTGAACA

ATGTTTGTGAACCTGTTGTAACTCAACCCAAACCAAAAATCGAGTCACCTAAACTGGAGAGAACTCCAAATGGCCCAAATATTGACAAGAAAGAAGATTT

AGAAGGCAAAAATAATCTTGGTGCTGAAGCTCCGCATCAGAATGGTGAATGCCACCCTAATGAGAAGGGCTCTGTCAACATGGACCTGGACTAGGCTCTG

TGCTGGCTCCCTCCCCCACTTCATGAGATGTGTTTGCCATAGTATGTGATCCTGTATAACAGACTGAGTCTATTTATATTTTCTTTTTTTTAAGACTGTC

TAGAAATTTTGTGTATTATGAGGGGAAAAAAGGAAAAGCTTGAATCTGTGTAGTCTCTGACCCTAAGTGAGAATGACTTTGGTGTCAGGGTCCTGTGGAG

TTGTGCCCCACACTGAGCTCTGTACAGTATTGCTGCTCATACACTGAGGAGGTGGGGTCGTCTTCTGAGGATATGAACTACACTGCTTGGTCACACGCTG

GGATCAGAATCTTAAGCAGTTATTCTTGCCAAGGGTTTTGTTTTGTTTTGCATTTTGCTCTTCATTTCCGCATGTGTGTGGCTGTGGTTGTTTATAAATG

AGACTAAGTCTGATTTGCATAAGGGCTTTCAAAAATTAAGTCTGTCCAGTAGAGTGATTTTGCTTTCATTATTACCAAGTCAAGAGTACAACAGAGCTAG

TGAACCGTAGCAGCATGCGAAGCAGGGCTGTGAACTATCACCACACAGTGCATTGTCCCGTGGAGGTGTGACACGGGAGACACACGTGTGGATCATGTGA

TCATTGTGAACACCTCGTGAGCTTTAAAATAAAGTCCACCCTGTGGTGTCATTTCT
Translation
MSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTP - UNI12189 - PSVISFGSKNRTIGVAAKNQ QITHANNTVSSFKRFHGRAFNDPFIQKEK

ENLSYDLVPMKNGGVGIK VMYMDEEHFFSVEQITAMLLTKLKETAENNLKKPVTDCVIS VPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAV VALN

YGIYKQDLPNAEEKPRVVVFVDMGHSSFQVSACAFNKGKLK VLGTAFDPFLGGKNFDEKLVEHFCAEFKTKYKLDAKSKIRALLRLHQECEKLKKLMSS

NSTDLPLNIECFMNDKDVSGKMNR RSQFEELCAELLQKIEVPLHSLMAQTQLKAEDVSAIEIVGGATRIPAVKERIAKFFGKDVSTTLNADEAVARGCA

LQ CAILSPAFKVREFSVTDAVPFPISLVWNHDSEETEG - UNI15106 - GVHEVFSRNHAAPFSKVLTFLRRGPFELEAFYSDPQGVPYPEAKIG 

- UNI15106 - GRFVVQNVSAQKDGEKSRVKVKVRVNTHGIFTISTASMVEKVPTEEEDGSSLEADMECPNQRPTESSDVD - UNI2679 - - UN

I15106 - ANEKKVDQPPEAKKPKIKVVNVELPVEANLVWQLGRDLLNMYIETE GKMIMQDKLEKERNDAKNAVEECVYEFRDKLCGPYEKFICEQ -

 UNI2614 - EHEKFLRLLTETEDWLYEEGEDQAKQAYIDKLEELM KMGTPVKVRFQEAEERPKVLEELGQRLQHYAKIAADFRGK DEKYNHIDESE

MKKVEKSVNEVMEWMNNVMNAQAKRSLDQDPVVRTHEIRAKVK ELNNVCEPVVTQPKPKIESPKLERTPNGPNIDKKEDLEGKNNLGAEAPHQNGECHP

NEKGSVNMDLD
Transcript ENSMUST00000076410
Sequence
GCAGTCTTGCAGGGTAAGCCGGAGGCATCTTCCCGACTGGTCGGGAGCAGGACGAGCACGCAGCGGACCCGAGGCGGAGGCGGACCGGGCCAGCCATGTC

GGTGGTTGGGCTAGACGTAGGCTCACAGAGCTGCTACATTGCGGTGGCGCGGGCCGGGGGCATCGAGACCATCGCCAACGAGTTCAGCGACCGCTGCACC

CC - UNI12189 - GTCAGTCATATCATTTGGATCAAAAAACAGAACAATTGGAGTTGCAGCCAAAAACCAG CAAATCACTCATGCAAACAATACGG

TCTCTAGCTTTAAGAGATTTCATGGCAGAGCATTCAATGACCCCTTCATTCAGAAGGAAAAGGAGAACCTGAGCTATGATTTGGTCCCAATGAAAAATGG

TGGCGTGGGAATAAAG GTCATGTACATGGATGAAGAACATTTCTTCAGTGTGGAGCAGATAACAGCCATGCTGCTGACTAAGTTAAAGGAAACTGCAGA

AAACAACCTCAAGAAGCCAGTGACAGACTGTGTCATCTCA GTCCCATCCTTCTTCACAGATGCTGAGCGAAGGTCTGTGCTGGATGCTGCGCAGATTGT

GGGCTTGAACTGCTTGCGGCTCATGAATGACATGACGGCTG TTGCTTTGAATTATGGGATTTATAAGCAAGATCTCCCGAATGCCGAGGAGAAGCCACG

GGTGGTGGTGTTTGTTGACATGGGACACTCATCTTTCCAAGTGTCTGCCTGTGCTTTTAACAAAGGAAAACTGAAG GTTCTAGGCACAGCTTTTGATCC

CTTCTTAGGAGGAAAGAACTTTGATGAGAAGCTAGTAGAACATTTTTGTGCTGAATTTAAAACCAAGTACAAATTGGATGCAAAATCCAAAATTCGAGCC

CTCCTTCGTCTCCATCAGGAGTGTGAAAAGTTGAAAAAGCTCATGAGTTCTAACAGCACGGACCTGCCGCTGAACATCGAGTGCTTTATGAATGACAAGG

ATGTCTCTGGGAAGATGAACAG GTCACAGTTTGAAGAACTGTGTGCTGAGCTCCTGCAAAAAATAGAGGTCCCCCTTCACTCGTTGATGGCACAGACTC

AGCTCAAGGCTGAAGATGTGAGTGCCATTGAGATAGTGGGAGGTGCCACAAGAATCCCAGCTGTGAAAGAAAGAATTGCCAAGTTCTTTGGAAAAGATGT

CAGCACCACGCTCAATGCAGACGAAGCTGTGGCCAGAGGCTGTGCACTGCAG TGTGCAATTCTTTCTCCGGCATTTAAAGTTAGAGAGTTCTCTGTCAC

CGATGCAGTTCCTTTTCCAATATCTCTGGTCTGGAACCACGACTCGGAAGAAACGGAAGG - UNI15106 - TGTGCACGAGGTGTTCAGTCGGAACC

ATGCTGCTCCTTTCTCCAAAGTGCTCACCTTCCTGAGAAGGGGGCCCTTTGAGCTAGAAGCTTTCTATTCTGACCCTCAAGGAGTTCCATATCCAGAAGC

AAAAATAG - UNI15106 - GCCGTTTTGTTGTTCAGAATGTTTCTGCACAGAAAGATGGAGAGAAGTCGAGAGTGAAGGTCAAAGTGCGTGTGAACA

CACATGGCATCTTCACCATCTCCACGGCTTCCATGGTGGAGAAGGTCCCGACCGAGGAAGAGGATGGCTCCTCTCTCGAGGCAGACATGGAATGTCCAAA

CCAGAGGCCAACAGAAAGCTCGGATGTGGAT - UNI15106 - AAAAATATCCAGCAAGACAACAGTGAAGCTGGAACACAGCCCCAGGTACAAACTG

ATGGTCAACAAACCTCACAGTCTCCCCCTTCACCTGAACTTACCTCAGAAGAAAGCAAAACCCCAGATGCTGACAAA - UNI2679 - GCAAATGAAA

AGAAAGTTGATCAGCCTCCAGAAGCCAAGAAACCTAAAATAAAGGTGGTAAATGTTGAGCTGCCTGTAGAAGCCAACTTGGTATGGCAGTTAGGGAGAGA

CCTTCTTAACATGTATATTGAGACAGAG GGCAAGATGATCATGCAAGACAAGCTGGAGAAGGAGCGGAACGACGCCAAGAACGCCGTGGAGGAGTGTGT

ATATGAGTTCAGGGACAAGCTATGTGGACCATATGAGAAATTCATATGTGAGCAG - UNI2614 - GAACATGAGAAGTTCTTGAGGCTTCTAACAGA

GACGGAAGACTGGCTGTATGAGGAAGGGGAGGACCAGGCTAAGCAGGCATACATTGACAAGTTGGAAGAGCTGATG AAAATGGGCACTCCTGTTAAAGT

CAGATTTCAAGAAGCTGAGGAACGACCGAAAGTGTTGGAGGAGCTGGGGCAGCGCCTGCAGCACTATGCCAAGATTGCAGCGGACTTCAGAGGCAAG GA

TGAGAAATACAACCACATTGATGAATCAGAAATGAAGAAGGTTGAGAAGTCTGTTAATGAGGTGATGGAGTGGATGAATAATGTCATGAATGCTCAGGCT

AAAAGAAGTCTTGATCAAGACCCTGTTGTTCGAACTCATGAAATCAGAGCGAAGGTCAAG GAATTGAACAATGTTTGTGAACCTGTTGTAACTCAACCC

AAACCAAAAATCGAGTCACCTAAACTGGAGAGAACTCCAAATGGCCCAAATATTGACAAGAAAGAAGATTTAGAAGGCAAAAATAATCTTGGTGCTGAAG

CTCCGCATCAGAATGGTGAATGCCACCCTAATGAGAAGGGCTCTGTCAACATGGACCTGGACTAGGCTCTGTGCTGGCTCCCTCCCCCACTTCATGAGAT

GTGTTTGCCATA GCAGAAAGCAATGCAGTGAACTTGTGGCCACTTCCTCTCTGGCTCAACACACATCTCCCCAAACACTTGTCACGGGGCCTTCTCATC

CTGACCCAGCTCCCACCACGCCCAGGAAAACGCTCTGACACAATCTTTTCCTCAGGTTCCATCCTCACAAAATGTCATTTACAACTATTTCACAAATGAA

GATCACAGACTGACTACGGTTACCCTCATCAGCCCATTTTGTGATCCAAGTCTTGTTTGAGAAATTTTGGACAATCCCCACAGATGTGTTTAATCCCGAG

AGGAGCTTTAAAAGAGACCATTCACTTTAGATCCACTAAAGAATTAAATGTAGCCCACTGAAGAAGGCAGACATTGTGTAGACGGAAAGCATTTGGCTAC

CTGACCATTAAAGCTACTGGGGCAACCTAAAGAC
Translation
MSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTP - UNI12189 - PSVISFGSKNRTIGVAAKNQ QITHANNTVSSFKRFHGRAFNDPFIQKEK

ENLSYDLVPMKNGGVGIK VMYMDEEHFFSVEQITAMLLTKLKETAENNLKKPVTDCVIS VPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAV VALN

YGIYKQDLPNAEEKPRVVVFVDMGHSSFQVSACAFNKGKLK VLGTAFDPFLGGKNFDEKLVEHFCAEFKTKYKLDAKSKIRALLRLHQECEKLKKLMSS

NSTDLPLNIECFMNDKDVSGKMNR RSQFEELCAELLQKIEVPLHSLMAQTQLKAEDVSAIEIVGGATRIPAVKERIAKFFGKDVSTTLNADEAVARGCA

LQ CAILSPAFKVREFSVTDAVPFPISLVWNHDSEETEG - UNI15106 - GVHEVFSRNHAAPFSKVLTFLRRGPFELEAFYSDPQGVPYPEAKIG 

- UNI15106 - GRFVVQNVSAQKDGEKSRVKVKVRVNTHGIFTISTASMVEKVPTEEEDGSSLEADMECPNQRPTESSDVD - UNI15106 - KNI

QQDNSEAGTQPQVQTDGQQTSQSPPSPELTSEESKTPDADK - UNI2679 - ANEKKVDQPPEAKKPKIKVVNVELPVEANLVWQLGRDLLNMYIETE

 GKMIMQDKLEKERNDAKNAVEECVYEFRDKLCGPYEKFICEQ - UNI2614 - EHEKFLRLLTETEDWLYEEGEDQAKQAYIDKLEELM KMGTPVK

VRFQEAEERPKVLEELGQRLQHYAKIAADFRGK DEKYNHIDESEMKKVEKSVNEVMEWMNNVMNAQAKRSLDQDPVVRTHEIRAKVK ELNNVCEPVVT

QPKPKIESPKLERTPNGPNIDKKEDLEGKNNLGAEAPHQNGECHPNEKGSVNMDLD 
Transcript ENSMUST00000110498
Sequence
GTGGCACGTGGAGGCGCCGGTGAGTAAAATGCTGCAGATTCTGGAAAGTTCTCCTCAGTAGGCTACATAAGGCTGAGCGATTGGGACCTCCCCTTTTGGA

TTGGTAGCTGAGCGGCGGCGGCTGCGTGAGAGAGGCGGGCGGCGGAGAGCGGTGGCAGAGACTGAGCGCAGTCTTGCAGGGTAAGCCGGAGGCATCTTCC

CGACTGGTCGGGAGCAGGACGAGCACGCAGCGGACCCGAGGCGGAGGCGGACCGGGCCAGCCATGTCGGTGGTTGGGCTAGACGTAGGCTCACAGAGCTG

CTACATTGCGGTGGCGCGGGCCGGGGGCATCGAGACCATCGCCAACGAGTTCAGCGACCGCTGCACCCC - UNI12189 - GTCAGTCATATCATTTG

GATCAAAAAACAGAACAATTGGAGTTGCAGCCAAAAACCAG CAAATCACTCATGCAAACAATACGGTCTCTAGCTTTAAGAGATTTCATGGCAGAGCAT

TCAATGACCCCTTCATTCAGAAGGAAAAGGAGAACCTGAGCTATGATTTGGTCCCAATGAAAAATGGTGGCGTGGGAATAAAG GTCCCATCCTTCTTCA

CAGATGCTGAGCGAAGGTCTGTGCTGGATGCTGCGCAGATTGTGGGCTTGAACTGCTTGCGGCTCATGAATGACATGACGGCTG TTGCTTTGAATTATG

GGATTTATAAGCAAGATCTCCCGAATGCCGAGGAGAAGCCACGGGTGGTGGTGTTTGTTGACATGGGACACTCATCTTTCCAAGTGTCTGCCTGTGCTTT

TAACAAAGGAAAACTGAAG GTTCTAGGCACAGCTTTTGATCCCTTCTTAGGAGGAAAGAACTTTGATGAGAAGCTAGTAGAACATTTTTGTGCTGAATT

TAAAACCAAGTACAAATTGGATGCAAAATCCAAAATTCGAGCCCTCCTTCGTCTCCATCAGGAGTGTGAAAAGTTGAAAAAGCTCATGAGTTCTAACAGC

ACGGACCTGCCGCTGAACATCGAGTGCTTTATGAATGACAAGGATGTCTCTGGGAAGATGAACAG GTCACAGTTTGAAGAACTGTGTGCTGAGCTCCTG

CAAAAAATAGAGGTCCCCCTTCACTCGTTGATGGCACAGACTCAGCTCAAGGCTGAAGATGTGAGTGCCATTGAGATAGTGGGAGGTGCCACAAGAATCC

CAGCTGTGAAAGAAAGAATTGCCAAGTTCTTTGGAAAAGATGTCAGCACCACGCTCAATGCAGACGAAGCTGTGGCCAGAGGCTGTGCACTGCAG TGTG

CAATTCTTTCTCCGGCATTTAAAGTTAGAGAGTTCTCTGTCACCGATGCAGTTCCTTTTCCAATATCTCTGGTCTGGAACCACGACTCGGAAGAAACGGA

AGG - UNI15106 - TGTGCACGAGGTGTTCAGTCGGAACCATGCTGCTCCTTTCTCCAAAGTGCTCACCTTCCTGAGAAGGGGGCCCTTTGAGCTAG

AAGCTTTCTATTCTGACCCTCAAGGAGTTCCATATCCAGAAGCAAAAATAG - UNI15106 - GCCGTTTTGTTGTTCAGAATGTTTCTGCACAGAAA

GATGGAGAGAAGTCGAGAGTGAAGGTCAAAGTGCGTGTGAACACACATGGCATCTTCACCATCTCCACGGCTTCCATGGTGGAGAAGGTCCCGACCGAGG

AAGAGGATGGCTCCTCTCTCGAGGCAGACATGGAATGTCCAAACCAGAGGCCAACAGAAAGCTCGGATGTGGAT - UNI15106 - AAAAATATCCAG

CAAGACAACAGTGAAGCTGGAACACAGCCCCAGGTACAAACTGATGGTCAACAAACCTCACAGTCTCCCCCTTCACCTGAACTTACCTCAGAAGAAAGCA

AAACCCCAGATGCTGACAAA - UNI2679 - GCAAATGAAAAGAAAGTTGATCAGCCTCCAGAAGCCAAGAAACCTAAAATAAAGGTGGTAAATGTTG

AGCTGCCTGTAGAAGCCAACTTGGTATGGCAGTTAGGGAGAGACCTTCTTAACATGTATATTGAGACAGAG GGCAAGATGATCATGCAAGACAAGCTGG

AGAAGGAGCGGAACGACGCCAAGAACGCCGTGGAGGAGTGTGTATATGAGTTCAGGGACAAGCTATGTGGACCATATGAGAAATTCATATGTGAGCAG -

 UNI2614 - GAACATGAGAAGTTCTTGAGGCTTCTAACAGAGACGGAAGACTGGCTGTATGAGGAAGGGGAGGACCAGGCTAAGCAGGCATACATTGA

CAAGTTGGAAGAGCTGATG AAAATGGGCACTCCTGTTAAAGTCAGATTTCAAGAAGCTGAGGAACGACCGAAAGTGTTGGAGGAGCTGGGGCAGCGCCT

GCAGCACTATGCCAAGATTGCAGCGGACTTCAGAGGCAAG GATGAGAAATACAACCACATTGATGAATCAGAAATGAAGAAGGTTGAGAAGTCTGTTAA

TGAGGTGATGGAGTGGATGAATAATGTCATGAATGCTCAGGCTAAAAGAAGTCTTGATCAAGACCCTGTTGTTCGAACTCATGAAATCAGAGCGAAGGTC

AAG GAATTGAACAATGTTTGTGAACCTGTTGTAACTCAACCCAAACCAAAAATCGAGTCACCTAAACTGGAGAGAACTCCAAATGGCCCAAATATTGAC

AAGAAAGAAGATTTAGAAGGCAAAAATAATCTTGGTGCTGAAGCTCCGCATCAGAATGGTGAATGCCACCCTAATGAGAAGGGCTCTGTCAACATGGACC

TGGACTAGGCTCTGTGCTGGCTCCCTCCCCCACTTCATGAGATGTGTTTGCCATAGTATGTGATCCTGTATAACAGACTGAGTCTATTTATATTTTCTTT

TTTTTAAGACTGTCTAGAAATTTTGTGTATTATGAGGGGAAAAAAGGAAAAGCTTGAATCTGTGTAGTCTCTGACCCTAAGTGAGAATGACTTTGGTGTC

AGGGTCCTGTGGAGTTGTGCCCCACACTGAGCTCTGTACAGTATTGCTGCTCATACACTGAGGAGGTGGGGTCGTCTTCTGAGGATATGAACTACACTGC

TTGGTCACACGCTGGGATCAGAATCTTAAGCAGTTATTCTTGCCAA
Translation
MSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTP - UNI12189 - PSVISFGSKNRTIGVAAKNQ QITHANNTVSSFKRFHGRAFNDPFIQKEK

ENLSYDLVPMKNGGVGIK VPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAV VALNYGIYKQDLPNAEEKPRVVVFVDMGHSSFQVSACAFNKGKLK 

VLGTAFDPFLGGKNFDEKLVEHFCAEFKTKYKLDAKSKIRALLRLHQECEKLKKLMSSNSTDLPLNIECFMNDKDVSGKMNR RSQFEELCAELLQKIEV

PLHSLMAQTQLKAEDVSAIEIVGGATRIPAVKERIAKFFGKDVSTTLNADEAVARGCALQ CAILSPAFKVREFSVTDAVPFPISLVWNHDSEETEG - 

UNI15106 - GVHEVFSRNHAAPFSKVLTFLRRGPFELEAFYSDPQGVPYPEAKIG - UNI15106 - GRFVVQNVSAQKDGEKSRVKVKVRVNTHG

IFTISTASMVEKVPTEEEDGSSLEADMECPNQRPTESSDVD - UNI15106 - KNIQQDNSEAGTQPQVQTDGQQTSQSPPSPELTSEESKTPDADK 

- UNI2679 - ANEKKVDQPPEAKKPKIKVVNVELPVEANLVWQLGRDLLNMYIETE GKMIMQDKLEKERNDAKNAVEECVYEFRDKLCGPYEKFICE

Q - UNI2614 - EHEKFLRLLTETEDWLYEEGEDQAKQAYIDKLEELM KMGTPVKVRFQEAEERPKVLEELGQRLQHYAKIAADFRGK DEKYNHID

ESEMKKVEKSVNEVMEWMNNVMNAQAKRSLDQDPVVRTHEIRAKVK ELNNVCEPVVTQPKPKIESPKLERTPNGPNIDKKEDLEGKNNLGAEAPHQNGE

CHPNEKGSVNMDLD

For any suggestions or comments, please send an email to unitrap@crg.es