Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029658 (4930434E21Rik)
Chromosomal location
Chr 5: 150331254 - 150414469 (+)
Description
RIKEN cDNA 4930434E21 gene Gene [Source:MGI Symbol;Acc:MGI:1923042]
RefSeq_dna
NM_029440 
RefSeq_peptide
NP_083716.2 
UniGene
Mm.136919 
MGI
MGI:1923042 
Uniprot/SPTREMBL
Q8BN84 Q9D5I8 
Human Ortholog
not available
Omim not available
UniTrap UNI30598
Vector Insertion
Chr 5: 150347435 - 150354993
Public Clones IST12819E1BBF1 (tigm) IST14989H8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31181
Vector Insertion
Chr 5: 150355064 - 150365790
Public Clones IST12397B2 (tigm) IST12791D11 (tigm) IST12678C1 (tigm) IST12384H4 (tigm)
IST12438B6 (tigm) IST11110E4 (tigm) IST12101H2 (tigm) IST12946E1 (tigm)
IST12696C10 (tigm) IST12722F5 (tigm) IST12644B10 (tigm) IST12757G9 (tigm)
IST12485G11 (tigm) IST12693F1 (tigm) IST12310H3 (tigm) IST11785G5 (tigm)
IST14959E8 (tigm) IST12102H2 (tigm) IST12987E2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19391
Vector Insertion
Chr 5: 150365790 - 150365821
Public Clones not available
Private Clones OST392375 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34616
Vector Insertion
Chr 5: 150369044 - 150376563
Public Clones IST12867H2 (tigm) IST12831B10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36437
Vector Insertion
Chr 5: 150387092 - 150390644
Public Clones IST14568B9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28506
Vector Insertion
Chr 5: 150408962 - 150414070
Public Clones IST10803H6 (tigm)
Private Clones OST29405 (lexicon)
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000121108
Sequence
GCTAAAGTAGTCACTGGACTGGATCGAGGGAAGAGAGCTTTATGAGCCAACTCCATACATGTACCAACTCCAG GGATGTGTGAACATTCTGTTTTTGGC

ATCTGTAGGTGAACTACTAAG AACATGGAAGAAGATGCCAAGAGTTGAGGACATGCCGAGCATCACTCTTCACAGCGTCATGGCCTCTCCAAACGCAGA

GTATGTCCGCTGGAAGGTGCACGGAGACTTCGTCTCTCAG - UNI30598 - CTGAATTACTATGAGTCTATGAAAGCTGTCATTTCCAGCTCCAATC

ACGAGCCCACAGCTTTAGTGATAG - UNI19391 - - UNI31181 - GCTCTCTCCTAAACCGCTTGGAACATGGAG - UNI19391 - GGTTC

ACTGTGGGAGCAACAGATATCAAGGAAAAGCTAAACGAAATAAGAAATGTTGGGAAGAATGTCAAGATGGGGAACAGCTCAGCATGCCTTGCTCTGCCCC

AAAGGCAAGCGGAATGCAATCGCACTGTGTTCCGTGTCCACAAGGGAGTCAAGGCGTTCTCCTTCTGCAGGAGGAAGAACCTGCTGGTGACAGGGGGGCT

GGATCGAATCATCAGGGTCTGGAATCCTTACCTGCCTGG AAAGCCAACAGGTGTGCTGAGAGGCCACCGGGCTCCGGTGATGTATGTACACGTCGCCTT

TGAAGAAAACAAAGTGTTTTCCATGTCTGCTGACAACACAGTCAAG - UNI34616 - GTCTGGGATCTGGAGACACATGGCTGCTGCTGTACCATCT

CTTCCAAAGCCAGTGGCATCAAGGGAGAACTCACAGCCTGCCTCTATCTCCCCGGACCTAGAGCCCTGTGTGTGGCCACGGGGACTCTGGCTTTCCTTCA

CCTGAAAGTGGG ATCTGTCCCAGAGTCCCACCTGGTACGTTCCCACCAAGAGCCCGTGGTGTGCTGCAGGTACAACCCAGCCTTCAGACATGTGGTCAG

CTGCTGCGAAGCCTCC GTAGTGAAAGTGTGGGACTTTGAAACGGGAAGACAGGTGTCAGAATTTATTGGCACTCATGGTAATGCTGGCATCACCTGTCT

GACCTTTGACTCCAGCGGAAGAAG GCTTGTTACTGGAGGAAGAGATGGCTGTCTGAAAATATGGAGCTACAACAATGGACACTGTCTGCACACCCTTCA

GCACG ATGAAAATCAAAGTGAAGTCTGTGACTGTACCTACATGGAGGTGAACCGAAATCG GTGTGTCATAGCTGTTGGATGGGACCGAAGAATAAACG

TGTATTTT GACATACCTCGAGATTTTCATCATTTCCGGAAGCCTCAGCCCCACTGGCAGGATGACCTG - UNI36437 - AACCATGGGCACAAGGA

GGACATTCTCTGTGTGGCTCAGTGCCCGCCTTTTCTTCTGGCCACCTCCAGTTACGATGGAGAGATAATAGTTTGGAATGTCATCTCAGGTCACATGTAC

TGCAAGCTGAACACCCCCAGCCCCATGGATGGCCAGGACCATAGAGAAG GCCCAGATAGAAGTGTTTCCCAGCTCGCCTTTCTAAAGACACGGCTGACG

AAGTTGGATTCAGCATCTGCTGCCCTCATCAGCAATGGGCCCGGAG GTTCTGTCTGTTTCTGGAAGCTCTTTAGTGGGTCTGGCCTCGTTGCAAACTTC

ACTCCG TCCAGAGAGAAAGCCCAGGTGAGCGGCATCGTGGTGACATCAGGAGACACTCTCGCTTACCTGGCTGACCAGCACGGCTTCATACATGTCTAT

GACATCCAGGAGTATGGCCTCCAGGGAACAGAGCTACAGGCTCCCAACA CCGTGACATCCTGGAGAGCTCACGTCAGCATGGTGACCTC CCTGGAGCT

GATCGAGGGGGGCAGCATCGTGCTGTCTTCCTCCCTTGACTGCACTGTGCGCCTGTGGAGCCAGGACGGGGCATACATAG GGACCTTTGGGCAGAATCA

CCCCTGGGATGTTTTCACTCCTGACTCATGGGGTCACCCAAGAGTCCCCTTTGAGATTCTGACAGATCCTCGGAGCATGCCTACCCACCGGGTACTGGAA

ACAGATGTACCTGCTGGATGCTTGGAAGGCCGGCAGGAGCAGGACCACGGGACAGAGGAGAAGGACCCGTGTGAG GCTGAAAAGACCCCTAACCCTCCC

TCCCCAGAAGGTCTCACTGTTGAAGCAGAGGCGAAAGCAGATAAGAGCCGATGGGCTGCATTTTGCCATGGCAG - UNI28506 - ACTACTGTCAGC

TCGAAGAAAGCCTCGCTGGAAGATGCCTGAGCTCAGATGGCCCAGCATTTACCAGGCCCTCCGGTGCCACGAGCTTGCCTTTGTGTCTGCTCTCGGGGAG

AAGCCAGATCTGTCTGTTCCTGGCTCTGACTTGTTCCCGGTTGGTTTCTGCAGCCAGGAGACAGAAGCAGCGCTACCAGAAAGGAAGAAACTCTCACCCT

GGAGCGGTTTCTTGCCCGAGTGCTAAGGACCTTGACCTCCTTGCTTGGCCAGTTCTTTCCTGTGTCATGGAAAGGTTTGGCTGAGCTTAAGGCTTTGACC

CCTGAGGCGTAGAAAAGAGCAAGATGAGAAATGATCTCAGCCCATGTGGGCTCATCCTGAAGCAATTAGAGTTGAAATTTCAGAGAA
Translation
MYQLQ GCVNILFLASVGELLR RTWKKMPRVEDMPSITLHSVMASPNAEYVRWKVHGDFVSQ - UNI30598 - LNYYESMKAVISSSNHEPTALVI

G - UNI19391 - - UNI31181 - GSLLNRLEHGG - UNI19391 - GFTVGATDIKEKLNEIRNVGKNVKMGNSSACLALPQRQAECNRTVFR

VHKGVKAFSFCRRKNLLVTGGLDRIIRVWNPYLPG GKPTGVLRGHRAPVMYVHVAFEENKVFSMSADNTVK - UNI34616 - VWDLETHGCCCTIS

SKASGIKGELTACLYLPGPRALCVATGTLAFLHLKVG GSVPESHLVRSHQEPVVCCRYNPAFRHVVSCCEAS VVKVWDFETGRQVSEFIGTHGNAGIT

CLTFDSSGRR RLVTGGRDGCLKIWSYNNGHCLHTLQHD DENQSEVCDCTYMEVNRNR RCVIAVGWDRRINVYF DIPRDFHHFRKPQPHWQDDL - 

UNI36437 - NHGHKEDILCVAQCPPFLLATSSYDGEIIVWNVISGHMYCKLNTPSPMDGQDHREG GPDRSVSQLAFLKTRLTKLDSASAALISNGPG

G GSVCFWKLFSGSGLVANFTP SREKAQVSGIVVTSGDTLAYLADQHGFIHVYDIQEYGLQGTELQAPNT TVTSWRAHVSMVTS SLELIEGGSIVLS

SSLDCTVRLWSQDGAYIG GTFGQNHPWDVFTPDSWGHPRVPFEILTDPRSMPTHRVLETDVPAGCLEGRQEQDHGTEEKDPCE AEKTPNPPSPEGLTV

EAEAKADKSRWAAFCHGR - UNI28506 - RLLSARRKPRWKMPELRWPSIYQALRCHELAFVSALGEKPDLSVPGSDLFPVGFCSQETEAALPERKK

LSPWSGFLPEC
Transcript ENSMUST00000110502
Sequence
GAGGAGACCTCAGCTCTCTGTTGATGGAAGGCTGTTGCTGTTTGACAGGCTGATGCCTCTTTGTTTGGAAAGATGAGTTAGAATCGTTAGCAG GGATGT

GTGAACATTCTGTTTTTGGCATCTGTAGGTGAACTACTAAG AACATGGAAGAAGATGCCAAGAGTTGAGGACATGCCGAGCATCACTCTTCACAGCGTC

ATGGCCTCTCCAAACGCAGAGTATGTCCGCTGGAAGGTGCACGGAGACTTCGTCTCTCAG - UNI30598 - CTGAATTACTATGAGTCTATGAAAGC

TGTCATTTCCAGCTCCAATCACGAGCCCACAGCTTTAGTGATAG - UNI19391 - - UNI31181 - GCTCTCTCCTAAACCGCTTGGAACATGGA

GGTGAGTGTCCTGGAGAAGCATCGGGAATCAGGAGATGCTGCTGAGTGTATCGAGGATCCTCAG GAGGAAGAACCTGCTGGTGACAGGGGGGCTGGATC

GAATCATCAGGGTCTGGAATCCTTACCTGCCTGG AAAGCCAACAGGTGTGCTGAGAGGCCACCGGGCTCCGGTGATGTATGTACACGTCGCCTTTGAAG

AAAACAAAGTGTTTTCCATGTCTGCTGACAACACAGTCAAG - UNI34616 - GTCTGGGATCTGGAGACACATGGCTGCTGCTGTACCATCTCTTCC

AAAGCCAGTGGCATCAAGGGAGAACTCACAGCCTGCCTCTATCTCCCCGGACCTAGAGCCCTGTGTGTGGCCACGGGGACTCTGGCTTTCCTTCACCTGA

AAGTGGG ATCTGTCCCAGAGTCCCACCTGGTACGTTCCCACCAAGAGCCCGTGGTGTGCTGCAGGTACAACCCAGCCTTCAGACATGTGGTCAGCTGCT

GCGAAGCCTCC GTAGTGAAAGTGTGGGACTTTGAAACGGGAAGACAGGTGTCAGAATTTATTGGCACTCATGGTAATGCTGGCATCACCTGTCTGACCT

TTGACTCCAGCGGAAGAAG GCTTGTTACTGGAGGAAGAGATGGCTGTCTGAAAATATGGAGCTACAACAATGGACACTGTCTGCACACCCTTCAGCACG

 ATGAAAATCAAAGTGAAGTCTGTGACTGTACCTACATGGAGGTGAACCGAAATCG GTGTGTCATAGCTGTTGGATGGGACCGAAGAATAAACGTGTAT

TTT GACATACCTCGAGATTTTCATCATTTCCGGAAGCCTCAGCCCCACTGGCAGGATGACCTG - UNI36437 - AACCATGGGCACAAGGAGGACA

TTCTCTGTGTGGCTCAGTGCCCGCCTTTTCTTCTGGCCACCTCCAGTTACGATGGAGAGATAATAGTTTGGAATGTCATCTCAGGTCACATGTACTGCAA

GCTGAACACCCCCAGCCCCATGGATGGCCAGGACCATAGAGAAG GCCCAGATAGAAGTGTTTCCCAGCTCGCCTTTCTAAAGACACGGCTGACGAAGTT

GGATTCAGCATCTGCTGCCCTCATCAGCAATGGGCCCGGAG GTTCTGTCTGTTTCTGGAAGCTCTTTAGTGGGTCTGGCCTCGTTGCAAACTTCACTCC

G TCCAGAGAGAAAGCCCAGGTGAGCGGCATCGTGGTGACATCAGGAGACACTCTCGCTTACCTGGCTGACCAGCACGGCTTCATACATGTCTATGACAT

CCAGGAGTATGGCCTCCAGGGAACAGAGCTACAGGCTCCCAACA CCGTGACATCCTGGAGAGCTCACGTCAGCATGGTGACCTC CCTGGAGCTGATCG

AGGGGGGCAGCATCGTGCTGTCTTCCTCCCTTGACTGCACTGTGCGCCTGTGGAGCCAGGACGGGGCATACATAG GGACCTTTGGGCAGAATCACCCCT

GGGATGTTTTCACTCCTGACTCATGGGGTCACCCAAGAGTCCCCTTTGAGATTCTGACAGATCCTCGGAGCATGCCTACCCACCGGGTACTGGAAACAGA

TGTACCTGCTGGATGCTTGGAAGGCCGGCAGGAGCAGGACCACGGGACAGAGGAGAAGGACCCGTGTGAG GCTGAAAAGACCCCTAACCCTCCCTCCCC

AGAAGGTCTCACTGTTGAAGCAGAGGCGAAAGCAGATAAGAGCCGATGGGCTGCATTTTGCCATGGCAG - UNI28506 - ACTACTGTCAGCTCGAA

GAAAGCCTCGCTGGAAGATGCCTGAGCTCAGATGGCCCAGCATTTACCAGGCCCTCCGGTGCCACGAGCTTGCCTTTGTGTCTGCTCTCGGGGAGAAGCC

AGATCTGTCTGTTCCTGGCTCTGACTTGTTCCCGGTTGGTTTCTGCAGCCAGGAGACAGAAGCAGCGCTACCAGAAAGGAAGAAACTCTCACCCTGGAGC

GGTTTCTTGCCCGAGTGCTAAGGACCTTGACCTCCTTGCTTGGCCAGTTCTTTCCTGTGTCATGGAAAGGTTTGGCTGAGCTTAAGGCTTTGACCCCTGA

GGCGTAGAAAAGAGCAAGATGAGAAATGATCTCAGCCCATGTGGGCTCATCCTGAAGCAATTAGAGTTGAAATTTCAGAGAA
Translation
   - UNI30598 -  - UNI19391 - - UNI31181 - MLLSVSRILR RRKNLLVTGGLDRIIRVWNPYLPG GKPTGVLRGHRAPVMYVHVAF

EENKVFSMSADNTVK - UNI34616 - VWDLETHGCCCTISSKASGIKGELTACLYLPGPRALCVATGTLAFLHLKVG GSVPESHLVRSHQEPVVCC

RYNPAFRHVVSCCEAS VVKVWDFETGRQVSEFIGTHGNAGITCLTFDSSGRR RLVTGGRDGCLKIWSYNNGHCLHTLQHD DENQSEVCDCTYMEVNR

NR RCVIAVGWDRRINVYF DIPRDFHHFRKPQPHWQDDL - UNI36437 - NHGHKEDILCVAQCPPFLLATSSYDGEIIVWNVISGHMYCKLNTPS

PMDGQDHREG GPDRSVSQLAFLKTRLTKLDSASAALISNGPGG GSVCFWKLFSGSGLVANFTP SREKAQVSGIVVTSGDTLAYLADQHGFIHVYDIQ

EYGLQGTELQAPNT TVTSWRAHVSMVTS SLELIEGGSIVLSSSLDCTVRLWSQDGAYIG GTFGQNHPWDVFTPDSWGHPRVPFEILTDPRSMPTHRV

LETDVPAGCLEGRQEQDHGTEEKDPCE AEKTPNPPSPEGLTVEAEAKADKSRWAAFCHGR - UNI28506 - RLLSARRKPRWKMPELRWPSIYQAL

RCHELAFVSALGEKPDLSVPGSDLFPVGFCSQETEAALPERKKLSPWSGFLPEC
Transcript ENSMUST00000085533
Sequence
GAGGAGACCTCAGCTCTCTGTTGATGGAAGGCTGTTGCTGTTTGACAGGCTGATGCCTCTTTGTTTGGAAAGATGAGTTAGAATCGTTAGCAG GGATGT

GTGAACATTCTGTTTTTGGCATCTGTAGGTGAACTACTAAG AACATGGAAGAAGATGCCAAGAGTTGAGGACATGCCGAGCATCACTCTTCACAGCGTC

ATGGCCTCTCCAAACGCAGAGTATGTCCGCTGGAAGGTGCACGGAGACTTCGTCTCTCAG - UNI30598 - CTGAATTACTATGAGTCTATGAAAGC

TGTCATTTCCAGCTCCAATCACGAGCCCACAGCTTTAGTGATAG - UNI19391 - - UNI31181 - GCTCTCTCCTAAACCGCTTGGAACATGGA

GGTGAGTGTCCTGGAGAAGCATCGGGAATCAGGAGATGCTGCTGAGTGTATCGAGGATCCTCAG GAGGAAGAACCTGCTGGTGACAGGGGGGCTGGATC

GAATCATCAGGGTCTGGAATCCTTACCTGCCTGG AAAGCCAACAGGTGTGCTGAGAGGCCACCGGGCTCCGGTGATGTATGTACACGTCGCCTTTGAAG

AAAACAAAGTGTTTTCCATGTCTGCTGACAACACAGTCAAG - UNI34616 - GTCTGGGATCTGGAGACACATGGCTGCTGCTGTACCATCTCTTCC

AAAGCCAGTGGCATCAAGGGAGAACTCACAGCCTGCCTCTATCTCCCCGGACCTAGAGCCCTGTGTGTGGCCACGGGGACTCTGGCTTTCCTTCACCTGA

AAGTGGG ATCTGTCCCAGAGTCCCACCTGGTACGTTCCCACCAAGAGCCCGTGGTGTGCTGCAGGTACAACCCAGCCTTCAGACATGTGGTCAGCTGCT

GCGAAGCCTCC GTAGTGAAAGTGTGGGACTTTGAAACGGGAAGACAGGTGTCAGAATTTATTGGCACTCATGGTAATGCTGGCATCACCTGTCTGACCT

TTGACTCCAGCGGAAGAAG GCTTGTTACTGGAGGAAGAGATGGCTGTCTGAAAATATGGAGCTACAACAATGGACACTGTCTGCACACCCTTCAGCACG

 ATGAAAATCAAAGTGAAGTCTGTGACTGTACCTACATGGAGGTGAACCGAAATCG GTGTGTCATAGCTGTTGGATGGGACCGAAGAATAAACGTGTAT

TTT GACATACCTCGAGATTTTCATCATTTCCGGAAGCCTCAGCCCCACTGGCAGGATGACCTG - UNI36437 - AACCATGGGCACAAGGAGGACA

TTCTCTGTGTGGCTCAGTGCCCGCCTTTTCTTCTGGCCACCTCCAGTTACGATGGAGAGATAATAGTTTGGAATGTCATCTCAGGTCACATGTACTGCAA

GCTGAACACCCCCAGCCCCATGGATGGCCAGGACCATAGAGAAG GCCCAGATAGAAGTGTTTCCCAGCTCGCCTTTCTAAAGACACGGCTGACGAAGTT

GGATTCAGCATCTGCTGCCCTCATCAGCAATGGGCCCGGAG GTTCTGTCTGTTTCTGGAAGCTCTTTAGTGGGTCTGGCCTCGTTGCAAACTTCACTCC

G TCCAGAGAGAAAGCCCAGGTGAGCGGCATCGTGGTGACATCAGGAGACACTCTCGCTTACCTGGCTGACCAGCACGGCTTCATACATGTCTATGACAT

CCAGGAGTATGGCCTCCAGGGAACAGAGCTACAGGCTCCCAACA CCGTGACATCCTGGAGAGCTCACGTCAGCATGGTGACCTC CCTGGAGCTGATCG

AGGGGGGCAGCATCGTGCTGTCTTCCTCCCTTGACTGCACTGTGCGCCTGTGGAGCCAGGACGGGGCATACATAG GGACCTTTGGGCAGAATCACCCCT

GGGATGTTTTCACTCCTGACTCATGGGGTCACCCAAGAGTCCCCTTTGAGATTCTGACAGATCCTCGGAGCATGCCTACCCACCGGGTACTGGAAACAGA

TGTACCTGCTGGATGCTTGGAAGGCCGGCAGGAGCAGGACCACGGGACAGAGGAGAAGGACCCGTGTGAG GGT
Translation
   - UNI30598 -  - UNI19391 - - UNI31181 - MLLSVSRILR RRKNLLVTGGLDRIIRVWNPYLPG GKPTGVLRGHRAPVMYVHVAF

EENKVFSMSADNTVK - UNI34616 - VWDLETHGCCCTISSKASGIKGELTACLYLPGPRALCVATGTLAFLHLKVG GSVPESHLVRSHQEPVVCC

RYNPAFRHVVSCCEAS VVKVWDFETGRQVSEFIGTHGNAGITCLTFDSSGRR RLVTGGRDGCLKIWSYNNGHCLHTLQHD DENQSEVCDCTYMEVNR

NR RCVIAVGWDRRINVYF DIPRDFHHFRKPQPHWQDDL - UNI36437 - NHGHKEDILCVAQCPPFLLATSSYDGEIIVWNVISGHMYCKLNTPS

PMDGQDHREG GPDRSVSQLAFLKTRLTKLDSASAALISNGPGG GSVCFWKLFSGSGLVANFTP SREKAQVSGIVVTSGDTLAYLADQHGFIHVYDIQ

EYGLQGTELQAPNT TVTSWRAHVSMVTS SLELIEGGSIVLSSSLDCTVRLWSQDGAYIG GTFGQNHPWDVFTPDSWGHPRVPFEILTDPRSMPTHRV

LETDVPAGCLEGRQEQDHGTEEKDPCE G
Transcript ENSMUST00000031665
Sequence
AATAACACCAGGTATGGGATAGCTATCCTCGGTATTGGCACCGCTAAAGTAGTCACTGGACTGGATCGAGGGAAGAGAGCTTTATGAGCCAACTCCATAC

ATGTACCAACTCCAG GGATGTGTGAACATTCTGTTTTTGGCATCTGTAGGTGAACTACTAAG AACATGGAAGAAGATGCCAAGAGTTGAGGACATGCC

GAGCATCACTCTTCACAGCGTCATGGCCTCTCCAAACGCAGAGTATGTCCGCTGGAAGGTGCACGGAGACTTCGTCTCTCAG - UNI30598 - CTGA

ATTACTATGAGTCTATGAAAGCTGTCATTTCCAGCTCCAATCACGAGCCCACAGCTTTAGTGATAG - UNI19391 - - UNI31181 - GGTTCAC

TGTGGGAGCAACAGATATCAAGGAAAAGCTAAACGAAATAAGAAATGTTGGGAAGAATGTCAAGATGGGGAACAGCTCAGCATGCCTTGCTCTGCCCCAA

AGGCAAGCGGAATGCAATCGCACTGTGTTCCGTGTCCACAAGGGAGTCAAGGCGTTCTCCTTCTGCAGGAGGAAGAACCTGCTGGTGACAGGGGGGCTGG

ATCGAATCATCAGGGTCTGGAATCCTTACCTGCCTGG - UNI34616 - GTCTGGGATCTGGAGACACATGGCTGCTGCTGTACCATCTCTTCCAAAG

CCAGTGGCATCAAGGGAGAACTCACAGCCTGCCTCTATCTCCCCGGACCTAGAGCCCTGTGTGTGGCCACGGGGACTCTGGCTTTCCTTCACCTGAAAGT

GGG ATCTGTCCCAGAGTCCCACCTGGTACGTTCCCACCAAGAGCCCGTGGTGTGCTGCAGGTACAACCCAGCCTTCAGACATGTGGTCAGCTGCTGCGA

AGCCTCC GTAGTGAAAGTGTGGGACTTTGAAACGGGAAGACAGGTGTCAGAATTTATTGGCACTCATGGTAATGCTGGCATCACCTGTCTGACCTTTGA

CTCCAGCGGAAGAAG GCTTGTTACTGGAGGAAGAGATGGCTGTCTGAAAATATGGAGCTACAACAATGGACACTGTCTGCACACCCTTCAGCACGGCAA

GTGGGGTGGGGACTCCAGCAAGTGGTCCCCATAAAGTGCGGACGCACAACTGTGCATTTATCATAAATGGGAAATGAATCAAGTAAAATCGTGCCTCGCA

G ATGAAAATCAAAGTGAAGTCTGTGACTGTACCTACATGGAGGTGAACCGAAATCG GTGTGTCATAGCTGTTGGATGGGACCGAAGAATAAACGTGTA

TTTT GACATACCTCGAGATTTTCATCATTTCCGGAAGCCTCAGCCCCACTGGCAGGATGACCTG - UNI36437 - AACCATGGGCACAAGGAGGAC

ATTCTCTGTGTGGCTCAGTGCCCGCCTTTTCTTCTGGCCACCTCCAGTTACGATGGAGAGATAATAGTTTGGAATGTCATCTCAGGTCACATGTACTGCA

AGCTGAACACCCCCAGCCCCATGGATGGCCAGGACCATAGAGAAG GCCCAGATAGAAGTGTTTCCCAGCTCGCCTTTCTAAAGACACGGCTGACGAAGT

TGGATTCAGCATCTGCTGCCCTCATCAGCAATGGGCCCGGAG GTTCTGTCTGTTTCTGGAAGCTCTTTAGTGGGTCTGGCCTCGTTGCAAACTTCACTC

CG TCCAGAGAGAAAGCCCAGGTGAGCGGCATCGTGGTGACATCAGGAGACACTCTCGCTTACCTGGCTGACCAGCACGGCTTCATACATGTCTATGACA

TCCAGGAGTATGGCCTCCAGGGAACAGAGCTACAGGCTCCCAACA CCGTGACATCCTGGAGAGCTCACGTCAGCATGGTGACCTC CCTGGAGCTGATC

GAGGGGGGCAGCATCGTGCTGTCTTCCTCCCTTGACTGCACTGTGCGCCTGTGGAGCCAGGACGGGGCATACATAG GGACCTTTGGGCAGAATCACCCC

TGGGATGTTTTCACTCCTGACTCATGGGGTCACCCAAGAGTCCCCTTTGAGATTCTGACAGATCCTCGGAGCATGCCTACCCACCGGGTACTGGAAACAG

ATGTACCTGCTGGATGCTTGGAAGGCCGGCAGGAGCAGGACCACGGGACAGAGGAGAAGGACCCGTGTGAG AAAGTCAGCTCTCCCTGGCCTTGGAACA

CAGCAACATGCTCAACCCTAGTGTCGAATCTGAGGACACTCAGCCCATACTTCCTATTCTGAGATGCATTTTAAAACATCTAATAACTGAGAGGAAGCTA

TGATCAGCTTAATGCCCAACTCCATGAGAATCAACGTCAGAGCAAGAGATTTGGAGAGGGCCCTGGGAGATGCAACCTTGATTTAGAGCTCCCATGAAAT

ATATGCATTTCCAAGAAATGCATGCCCTTTAATAAATTGAAAAGAAGGTC
Translation
   - UNI30598 -  - UNI19391 - - UNI31181 -  - UNI34616 -    MNQVKSCLAD DENQSEVCDCTYMEVNRNR RCVIAVGWD

RRINVYF DIPRDFHHFRKPQPHWQDDL - UNI36437 - NHGHKEDILCVAQCPPFLLATSSYDGEIIVWNVISGHMYCKLNTPSPMDGQDHREG G

PDRSVSQLAFLKTRLTKLDSASAALISNGPGG GSVCFWKLFSGSGLVANFTP SREKAQVSGIVVTSGDTLAYLADQHGFIHVYDIQEYGLQGTELQAP

NT TVTSWRAHVSMVTS SLELIEGGSIVLSSSLDCTVRLWSQDGAYIG GTFGQNHPWDVFTPDSWGHPRVPFEILTDPRSMPTHRVLETDVPAGCLEG

RQEQDHGTEEKDPCE KVSSPWPWNTATCSTLVSNLRTLSPYFLF

For any suggestions or comments, please send an email to unitrap@crg.es