Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029676 (Pot1a)
Chromosomal location
Chr 6: 25693735 - 25759226 (-)
Description
protection of telomeres 1A Gene [Source:MGI (curated);Acc:Pot1a-001]
RefSeq_dna
NM_133931 
RefSeq_peptide
NP_598692.1 
UniGene
Mm.274589 Mm.397208 
MGI
MGI:2141503 
Uniprot/SWISSPROT
Q91WC1 
Uniprot/SPTREMBL
Q3UXR7 Q3UVD7 
Human Ortholog
ENSG00000128513 (POT1)
Omim not available
UniTrap UNI17561
Vector Insertion
Chr 6: 25755942 - 25759174
Public Clones (sanger) 3SE224H06 (ggtc) 5SE224H06 (ggtc)
Private Clones OST440717 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22924
Vector Insertion
Chr 6: 25750511 - 25755874
Public Clones 5SE041F01 (ggtc)
Private Clones OST281128 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9521
Vector Insertion
Chr 6: 25707684 - 25708904
Public Clones RRA096 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115327
Sequence
AGTTGTCCGCGGGTTTTGCTG - UNI17561 - GGAAAACTCAGTTGCTCCTTAATGCTTTGTGGAAGTCAAGCAGCTGTTTTGAAGATTATACTTTA

AG - UNI22924 - AGGCTGGATTGTCCTAACAAGGAGCATCTGCATGCTACAGAGGCTGAAACCCCATAGCTGTTCAGCCAATCTGTTTGATGCCTC

AGCAGTCTCTATCTTCGGTTGTGGAAAGCCTACAGAATTTCTGCAGAACCTTTGGAAGACTCAAGAAGCTGGCATCTGATGTCAGTAAAGTATAGCAGCA

GCAGCAGCAGTGGGGCTGATGCACTCACCAGCAGGAATGAAAG ATTTATGATAAATCTGTGAGAGGATTTTTCATCAAACAATGTCTTTG GTTTCAAC

AGCTCCCTATACATATACACCCCTGAATCTACTCAAGGAAGGTACAATTGCCAATGTCTATGGTGTTGTGAAATTCTTTAAGCCTCCGTATGTTAGCAAA

GGAACTG ATTATTGCTCAGTTGTAACAATTGTGGACCAGACAAATGTGAAGTTAACCTGTATGCTCTTTAGTGGAAACTATGAAGCCCTCCCCATCATT

TATAAAGTTGGAGACATTGTTCGCTTCCACAGGCTGAAG ATCCAAGTGTATAAAAATGAGCTTCAGGGAATCAACTGCTCTGGCTTCGCCTCTTTGACA

TTTGAAGGGACTGTAGGGATGCCTGTCACAGCACGCACTTCCAGCAAAGTTTTTAGCTTCACTCCTCAGGACCAAAAAATGGTAGAAGCTTTGCGGGTTT

GGGCATCCAAGCACATCTCGGCGTCTTCAACTTTAGTGCAGCTGTGCGATGCGCAGCCCATGCAGTATTACGACCTGACCTGTCAGCTCCTGGGTAAAGC

ACAAGTGGATTCCACAGCATTTCTTCTAAAG GTATGGGATGGAACCCAGACTGTGCTTCCCTCCTGGAGAGTCTCCACACAAGATCTAACTTTTGAAGG

TGACTTGAGTCACATCGAACGGCTACAGAGTCTGGTGGTAGACATTCTAGTCTACGATAACCACGTTCAAGTGGCGAGATCCATCGAG GTTGGATGCTT

TCTAAGACTCTATAGCCTCCATACAAAACTTCAGCCTGGAAATTCAGAAACCAGCAGTTCTGAATCATTAAGGCTGGAGTTCCATCTCCACGGAGGGACC

AGTTATGGTCGGGGCATTAGGGTTTTGCCAGATACAAGCCCTTGTGTGGATCAGCTGAAAAA - UNI9521 - AGCTTTAGAAGGTGCAAATTTGCCA

GTCACTGAGACCTCAACTGGTATCTGTCAATCAGAAAATGGGGACAGCTCTGCACTATCAAGTAAGGACAATTTATAACGCTGATCTTTCACTTCCTCAT

AAGTGTAAGCACACTTTCCTTTTCAGTGTTTTCTTACATGGGTCTCTCTTTTCAGTTCATCTGACTATAATACAGGGTATATGTGCATGTTCATTAAAGT

AACTCATTAAACATATTTTTTGTCTTACATGGGTCTCTCTTTTCAGTTCATCCGACTATAATACAGGGTATATGTGCATGTTCATTAAAGTAACGCATTA

AACATATTTTTTGTCTTACATGGGTCTCTCTTTTCAGTTCATCCGACTATAATACAGGGTATATGTGTATGTTCATTAAAGTAACTCATTAAACATATTT

TTTGTCTTACATAGGTCTCTCTTTTCAGTTCATCTGACTATAATACAGGGTATATGTGTATGTTCATTAAAGTAACTCATTAAACATTTTTTTTGTCTTA

CATGGGTCTCTCTTTTCAGTTCATCTGACTATAATACAGGGTATATGTGCATGTTCATTAAAGTAACTCATTAAACATTTATTTTGTCCTACACACTATC

AAGCTTGGTTCACCCTTAAATATATAATCATATTTTTAAATAAAAGAATAATATTTACTTGATTTTTGATATGTGTATATAGTGTTTTGTATTCATGCAC

ACAAAAACATTACATGAATTCCCTAAGCAACCATTTCCTTGTCAGTTTCTAAAAGGAACAAAAGGCATTGGTACTCCCTTGTCTTAATTAGCCCAAGTTG

GTTTTTGCCCAAACCTGGCAGTCTAATGCATAAGCATGAGTCATCTAAATCTCTCAAAGACAACCTTCTTGTTGATCTTAATGGGATTGCTTTTGGATAC

ACCATGTGCTGAGATTCATCTATGCTGGAACCTGTGCCCTTGGTTCATTTCCTCATGCTGAGAGATGTGCTGATGAGTGGATATGGGGTTAGAAGCACTG

TCTGTGTCCTTTCCATGTTTATGTGGCTTTAGTATCTACCAAAACATCCAGTGGCTATAAATACGCTTTTGGGGGGGTCGAAGGTATCACTTAATTGGTT

TATTTAGACGTATACACCATCTTTCAGTAATAATTCCTAGTAGTCACAAAACCATTTCTTAAAAGACAAAAACACCCCCCGCCCCCACCCCCCC
Translation
 - UNI17561 -  - UNI22924 -  MSL VSTAPYTYTPLNLLKEGTIANVYGVVKFFKPPYVSKGTD DYCSVVTIVDQTNVKLTCMLFSGNYEA

LPIIYKVGDIVRFHRLK IQVYKNELQGINCSGFASLTFEGTVGMPVTARTSSKVFSFTPQDQKMVEALRVWASKHISASSTLVQLCDAQPMQYYDLTCQ

LLGKAQVDSTAFLLK VWDGTQTVLPSWRVSTQDLTFEGDLSHIERLQSLVVDILVYDNHVQVARSIE VGCFLRLYSLHTKLQPGNSETSSSESLRLEF

HLHGGTSYGRGIRVLPDTSPCVDQLKK - UNI9521 - KALEGANLPVTETSTGICQSENGDSSALSSKDNL
Transcript ENSMUST00000115329
Sequence
ATGACGTCACAGGCGCCTAGGTCCAGACTTTAGTTGTCCGCGGGTTTTGCTG - UNI17561 - GGAAAACTCAGTTGCTCCTTAATGCTTTGTGGAA

GTCAAGCAGCTGTTTTGAAGATTATACTTTAAG - UNI22924 - AGGCTGGATTGTCCTAACAAGGAGCATCTGCATGCTACAGAGGCTGAAACCCC

ATAGCTGTTCAGCCAATCTGTTTGATGCCTCAGCAGTCTCTATCTTCGGTTGTGGAAAGCCTACAGAATTTCTGCAGAACCTTTGGAAGACTCAAGAAGC

TGGCATCTGATGTCAGTAAAGTATAGCAGCAGCAGCAGCAGTGGGGCTGATGCACTCACCAGCAGGAATGAAAG ATTTATGATAAATCTGTGAGAGGAT

TTTTCATCAAACAATGTCTTTG GTTTCAACAGCTCCCTATACATATACACCCCTGAATCTACTCAAGGAAGGTACAATTGCCAATGTCTATGGTGTTGT

GAAATTCTTTAAGCCTCCGTATGTTAGCAAAGGAACTG ATTATTGCTCAGTTGTAACAATTGTGGACCAGACAAATGTGAAGTTAACCTGTATGCTCTT

TAGTGGAAACTATGAAGCCCTCCCCATCATTTATAAAGTTGGAGACATTGTTCGCTTCCACAGGCTGAAG ATCCAAGTGTATAAAAATGAGCTTCAGGG

AATCAACTGCTCTGGCTTCGCCTCTTTGACATTTGAAGGGACTGTAGGGATGCCTGTCACAGCACGCACTTCCAGCAAAGTTTTTAGCTTCACTCCTCAG

GACCAAAAAATGGTAGAAGCTTTGCGGGTTTGGGCATCCAAGCACATCTCGGCGTCTTCAACTTTAGTGCAGCTGTGCGATGCGCAGCCCATGCAGTATT

ACGACCTGACCTGTCAGCTCCTGGGTAAAGCACAAGTGGATTCCACAGCATTTCTTCTAAAG GTATGGGATGGAACCCAGACTGTGCTTCCCTCCTGGA

GAGTCTCCACACAAGATCTAACTTTTGAAGGTGACTTGAGTCACATCGAACGGCTACAGAGTCTGGTGGTAGACATTCTAGTCTACGATAACCACGTTCA

AGTGGCGAGATCCATCGAG GTTGGATGCTTTCTAAGACTCTATAGCCTCCATACAAAACTTCAGCCTGGAAATTCAGAAACCAGCAGTTCTGAATCATT

AAGGCTGGAGTTCCATCTCCACGGAGGGACCAGTTATGGTCGGGGCATTAGGGTTTTGCCAGATACAAGCCCTTGTGTGGATCAGCTGAAAAA - UNI9

521 - AGCTTTAGAAGGTGCAAATTTGCCAGTCACTGAGACCTCAACTGGTATCTGTCAATCAGAAAATGGGGACAGCTCTGCACTATCAA - UNI95

21 - ACTCAGGATCAGGTGCAGTATCACCTTATGAAGAAGAACGATGTCAACAAGTCTCTGCTACAA TACTTACCAATCACCAACATTTAGAGAAAAC

ACCACTGTGTGCCATCTTGACGCAAAAAGCTCCTCAACAATATCGAGTCCGCGCCAAACTGAGATCCTATTTGCCCAGGAGACTTTCCCAGTCTGTTAAA

CTTCTCTGTCCTAAATGTCATTCAGT ACAAGAAGTTCCACATGGGGACAGTTTGGATAAAATTTTGCAAGATGCTGCAACTGAAGCTCCAGACATCAAG

CTGAAAGCGACATCATTGTATTATTCAAAAGTCTGGACCACTGAAGACCAGGGCGGACGGCAGGTCGCTGTTCATTTTGTGAAAAATAATGGCATTCTCC

CTGCTTCAAGTGAATGTCTAATTTTGATAGAAG GAGGAAGGCTCTGCGAAGTCTCTAAACTGTCCAGCAAGTTCCACAGTGTGATGCCTGTGCGGTCCG

GCCCTGAGAGCCTGGAGCTCCTTACCCTTTCAGCCCCGTTCCTCATACAGGGAAAGGTGCATCACTATGG ATGTAAACAGTGCTCAAGCTTGAAACCTA

TACAAAATCTAAACTCCCGTTTTCATAAAGGACCGTGGACTCCTTCCTCTGTGGCAGAAGGTTAGATAAATTGCTATGTTATGCAGTTTCAATTCTCCCT

ATCGTCTCACTGATTTGTTCTTTAATATTTATTGAATTTTTTTTGTCAGCATTAGGCTAACTTTGCTAAGTTGAAATCTGTTTACAGTAATTGTTTTGAG

GATGAGGACTGAATGTTTAAATTACTTGCGAATATTTCCAAGCTTCGTAATCACATTCACATTTTAGTACTTGGTCGTTTGTTTTCCATTTAATCATTGA

TCGCAAACATAGGTCCTGAGCAAATCCTTCTGACTCTTATTCTAGCGTTGGAAGAGATGTTGAGATGACTGTTACATTCCTCCCAAGTCTTTAGCCAGGG

AGAGGAGTCTTTCTCTCTTAAATGCATCACTTATCACTTTGCCCTTGTCTACAGCTCCCACGACCAGGGCAATTTCTAGATAGTCATTAATAATTGGAGC

CAAGTCTATACAGAAGTTACATGGGCCATGTCCTGTCTACTAGAATTATTCAGTGTATGTATCCATTCAATCTTCTATAAGGAAAACACTCCAGGTTTGA

CAGTATCTATTGTGCCTCCATTGAGTTTATATTTTAAAGCCGACACTCTCCCTCCCTTTATCACTTTTCCTCATTCCTTTCTCCTTTATCTTCTCCACGA

GCATTCCACTTGGCCAATTCGCTAATCAGAATTTATCTTTCAAAGATATTGACAGCTGTAGGTATCGTTTGGGAAACTCAGAATAATTTTTTTAATGATC

ACTCAGATTCTTCCTGCTAGACTGGAGTTTTGTTACATAAACTATCTTATATAAATAGATGTGCACTTACGGGGGGATTGCTTTTTATGTCTAGCTTCAT

GATATGACTATGTCATACCCTGCAGTCTATGTTACTATGAACTGAACTGGGTAATCCCCTTTCGCATTTCTCAGCACAGTTTTTGAGTCCACCATTTTTG

TTTCAGTGTAACCTCTGGGGTGCCTTTTGAAGCTCCGAACTCTGTTCCTCTGTTATTGCTATTGAATACTAAAATTCTGTCTGTTGCCAATTTATTCTTC

TGCCTCATCTGCCTGTTTAATTAATTCTCTACTGGAATATGGGCTGTGTGGATGGAAGGTAATATAATATCCTATACATGTATGCAGTTTCTTCAACTTT

TCAGTAAAAGGATGTTTACCCTATTGGCAAATTCTCATGTGATTTGGTGTATCTAATTTATTAATTCTTCTTCACCCTCGCAAATTACGGAATCCCAGAT

TCTAACAATTTTATTCCTTCAGCCAAATAACTCCT
Translation
 - UNI17561 -  - UNI22924 -  MSL VSTAPYTYTPLNLLKEGTIANVYGVVKFFKPPYVSKGTD DYCSVVTIVDQTNVKLTCMLFSGNYEA

LPIIYKVGDIVRFHRLK IQVYKNELQGINCSGFASLTFEGTVGMPVTARTSSKVFSFTPQDQKMVEALRVWASKHISASSTLVQLCDAQPMQYYDLTCQ

LLGKAQVDSTAFLLK VWDGTQTVLPSWRVSTQDLTFEGDLSHIERLQSLVVDILVYDNHVQVARSIE VGCFLRLYSLHTKLQPGNSETSSSESLRLEF

HLHGGTSYGRGIRVLPDTSPCVDQLKK - UNI9521 - KALEGANLPVTETSTGICQSENGDSSALSN - UNI9521 - NSGSGAVSPYEEERCQQ

VSATI ILTNHQHLEKTPLCAILTQKAPQQYRVRAKLRSYLPRRLSQSVKLLCPKCHSV VQEVPHGDSLDKILQDAATEAPDIKLKATSLYYSKVWTTE

DQGGRQVAVHFVKNNGILPASSECLILIEG GGRLCEVSKLSSKFHSVMPVRSGPESLELLTLSAPFLIQGKVHHYG GCKQCSSLKPIQNLNSRFHKGP

WTPSSVAEG
Transcript ENSMUST00000031687
Sequence
ATGAG GTTG GTTTCAACAGCTCCCTATACATATACACCCCTGAATCTACTCAAGGAAGGTACAATTGCCAATGTCTATGGTGTTGTGAAATTCTTTAA

GCCTCCGTATGTTAGCAAAGGAACTG ATTATTGCTCAGTTGTAACAATTGTGGACCAGACAAATGTGAAGTTAACCTGTATGCTCTTTAGTGGAAACTA

TGAAGCCCTCCCCATCATTTATAAAGTTGGAGACATTGTTCGCTTCCACAGGCTGAAG ATCCAAGTGTATAAAAATGAGCTTCAGGGAATCAACTGCTC

TGGCTTCGCCTCTTTGACATTTGAAGGGACTGTAGGGATGCCTGTCACAGCACGCACTTCCAGCAAAGTTTTTAGCTTCACTCCTCAGGACCAAAAAATG

GTAGAAGCTTTGCGGGTTTGGGCATCCAAGCACATCTCGGCGTCTTCAACTTTAGTGCAGCTGTGCGATGCGCAGCCCATGCAGTATTACGACCTGACCT

GTCAGCTCCTGGGTAAAGCACAAGTGGATTCCACAGCATTTCTTCTAAAG GTATGGGATGGAACCCAGACTGTGCTTCCCTCCTGGAGAGTCTCCACAC

AAGATCTAACTTTTGAAGGTGACTTGAGTCACATCGAACGGCTACAGAGTCTGGTGGTAGACATTCTAGTCTACGATAACCACGTTCAAGTGGCGAGATC

CATCGAG GTTGGATGCTTTCTAAGACTCTATAGCCTCCATACAAAACTTCAGCCTGGAAATTCAGAAACCAGCAGTTCTGAATCATTAAGGCTGGAGTT

CCATCTCCACGGAGGGACCAGTTATGGTCGGGGCATTAGGGTTTTGCCAGATACAAGCCCTTGTGTGGATCAGCTGAAAAA - UNI9521 - AGCTTT

AGAAGGTGCAAATTTGCCAGTCACTGAGACCTCAACTGGTATCTGTCAATCAGAAAATGGGGACAGCTCTGCACTATCAA - UNI9521 - ACTCAGG

ATCAGGTGCAGTATCACCTTATGAAGAAGAACGATGTCAACAAGTCTCTGCTACAA TACTTACCAATCACCAACATTTAGAGAAAACACCACTGTGTGC

CATCTTGACGCAAAAAGCTCCTCAACAATATCGAGTCCGCGCCAAACTGAGATCCTATTTGCCCAGGAGACTTTCCCAGTCTGTTAAACTTCTCTGTCCT

AAATGTCATTCAGT ACAAGAAGTTCCACATGGGGACAGTTTGGATAAAATTTTGCAAGATGCTGCAACTGAAGCTCCAGACATCAAGCTGAAAGCGACA

TCATTGTATTATTCAAAAGTCTGGACCACTGAAGACCAGGGCGGACGGCAGGTCGCTGTTCATTTTGTGAAAAATAATGGCATTCTCCCTGCTTCAAGTG

AATGTCTAATTTTGATAGAAG GAGGAAGGCTCTGCGAAGTCTCTAAACTGTCCAGCAAGTTCCACAGTGTGATGCCTGTGCGGTCCGGCCCTGAGAGCC

TGGAGCTCCTTACCCTTTCAGCCCCGTTCCTCATACAGGGAAAGGTGCATCACTATGG ATGTAAACAGTGCTCAAGCTTGAAACCTATACAAAATCTAA

ACTCCCGTTTTCATAAAGGACCGTGGACTCCTTCCTCTGTGGCAGAAG CCCTGGGCGTTGTGCCGCTGCAGTATGTGTTTGTTATGGTTTTCACTCTGG

ATGACGGGACAGGGGTGTTGGAAGCTTACCTCAAGGATTCT GAACACTTTTTCAAGATCCCAGCATCTGAAGTCCTCACTGATGACGACCTTCAGAGAA

GTCTAGAAACGATCATGGATATGATATGTCCCCCAGGAATAAAAGTTG ATGCATACCCATGGCTAGAGTGCCTCCTCAAGTCCTACAATGTCACCATCG

GAACAGAGCGACGAATTTGCTACCAGATTTTTGATACTACAGTTGCAGAAAATGTTGTCTAGTACTGCCATTGAGTGCAGTGTGTATGGGATTTTACAGT

TTTAGAAAAGATCATGACTCTTTGAGATTCCCAGAAGACATTTTGCTATTGTGAAAAAGTGTTTTATCCTTTTTCACTATAGTTTAGTAATTTGTACAGA

AAAATATTTTATTGTTATTTATGCTGTCTTGTGAACATATCAAAAATCCCTTGTTGCTCATCATGTCGTGGGAGGTACAAAATGAGGCAGCACTGGTTGG

GGAGAACCAGGCTTTCTTGGCTCTCATTTATAAAACACTGGGAGCTGATTTTACTTCTGTGCTGTTTGATGTTTGGGTTTTTGTTGTTGTTGTTGTTGTT

TGTTTTGTTTTGTTTTTTATACCGAAGAATCTGCTTAGCAACTTCTGAACGGATTCTCCCTCTGCATCCACACATGAGTATCAGGTTAACTGCGTGCCGG

TTGAACAGATGCTTGTCTCGGTGAGCCTGGCTGTACTGATGTACTTTCAGAAGACGTATGGTTTATTTGGGTGCTCTGGTCGCCCACTTTAGCGTAAGTG

TAGCTCTGTGAACCGAAGAGTATGCCTGACCTTCAGCATTTCTCTACAACATTAGAAGTTGCTTCATTGCCCACCAGCGAATAAAGTGATGAGATTTATG

ATTTTTGTGTCTGTGTGTGTGTGTGAATCATCTGTATCTTCTCTTTTTTGGTAGTCTTATGTAAAGTATTCCCGTATTGCATTATTGAGGTCTTAGCACA

ATTGAATGTTCTGCATTTTTTTCAACAGTGTTTATCAATTTGCATGGGCTTTTATTTTTGAAAAAGAAATATTTTGTACAATATAGTTTGATGAATTTTC

TGTTCCTT
Translation
MR RL VSTAPYTYTPLNLLKEGTIANVYGVVKFFKPPYVSKGTD DYCSVVTIVDQTNVKLTCMLFSGNYEALPIIYKVGDIVRFHRLK IQVYKNELQ

GINCSGFASLTFEGTVGMPVTARTSSKVFSFTPQDQKMVEALRVWASKHISASSTLVQLCDAQPMQYYDLTCQLLGKAQVDSTAFLLK VWDGTQTVLPS

WRVSTQDLTFEGDLSHIERLQSLVVDILVYDNHVQVARSIE VGCFLRLYSLHTKLQPGNSETSSSESLRLEFHLHGGTSYGRGIRVLPDTSPCVDQLKK

 - UNI9521 - KALEGANLPVTETSTGICQSENGDSSALSN - UNI9521 - NSGSGAVSPYEEERCQQVSATI ILTNHQHLEKTPLCAILTQKA

PQQYRVRAKLRSYLPRRLSQSVKLLCPKCHSV VQEVPHGDSLDKILQDAATEAPDIKLKATSLYYSKVWTTEDQGGRQVAVHFVKNNGILPASSECLIL

IEG GGRLCEVSKLSSKFHSVMPVRSGPESLELLTLSAPFLIQGKVHHYG GCKQCSSLKPIQNLNSRFHKGPWTPSSVAEA ALGVVPLQYVFVMVFTL

DDGTGVLEAYLKDS EHFFKIPASEVLTDDDLQRSLETIMDMICPPGIKVD DAYPWLECLLKSYNVTIGTERRICYQIFDTTVAENVV
Transcript ENSMUST00000115330
Sequence
ATGACGTCACAGGCGCCTAGGTCCAGACTTTAGTTGTCCGCGGGTTTTGCTG - UNI17561 - GGAAAACTCAGTTGCTCCTTAATGCTTTGTGGAA

GTCAAGCAGCTGTTTTGAAGATTATACTTTAAG - UNI22924 - AGGCTGGATTGTCCTAACAAGGAGCATCTGCATGCTACAGAGGCTGAAACCCC

ATAGCTGTTCAGCCAATCTGTTTGATGCCTCAGCAGTCTCTATCTTCGGTTGTGGAAAGCCTACAGAATTTCTGCAGAACCTTTGGAAGACTCAAGAAGC

TGGCATCTGATGTCAGTAAAGTATAGCAGCAGCAGCAGCAGTGGGGCTGATGCACTCACCAGCAGGAATGAAAG ATTTATGATAAATCTGTGAGAGGAT

TTTTCATCAAACAATGTCTTTG GTTTCAACAGCTCCCTATACATATACACCCCTGAATCTACTCAAGGAAGGTACAATTGCCAATGTCTATGGTGTTGT

GAAATTCTTTAAGCCTCCGTATGTTAGCAAAGGAACTG ATTATTGCTCAGTTGTAACAATTGTGGACCAGACAAATGTGAAGTTAACCTGTATGCTCTT

TAGTGGAAACTATGAAGCCCTCCCCATCATTTATAAAGTTGGAGACATTGTTCGCTTCCACAGGCTGAAG ATCCAAGTGTATAAAAATGAGCTTCAGGG

AATCAACTGCTCTGGCTTCGCCTCTTTGACATTTGAAGGGACTGTAGGGATGCCTGTCACAGCACGCACTTCCAGCAAAGTTTTTAGCTTCACTCCTCAG

GACCAAAAAATGGTAGAAGCTTTGCGGGTTTGGGCATCCAAGCACATCTCGGCGTCTTCAACTTTAGTGCAGCTGTGCGATGCGCAGCCCATGCAGTATT

ACGACCTGACCTGTCAGCTCCTGGGTAAAGCACAAGTGGATTCCACAGCATTTCTTCTAAAG GTATGGGATGGAACCCAGACTGTGCTTCCCTCCTGGA

GAGTCTCCACACAAGATCTAACTTTTGAAGGTGACTTGAGTCACATCGAACGGCTACAGAGTCTGGTGGTAGACATTCTAGTCTACGATAACCACGTTCA

AGTGGCGAGATCCATCGAG GTTGGATGCTTTCTAAGACTCTATAGCCTCCATACAAAACTTCAGCCTGGAAATTCAGAAACCAGCAGTTCTGAATCATT

AAGGCTGGAGTTCCATCTCCACGGAGGGACCAGTTATGGTCGGGGCATTAGGGTTTTGCCAGATACAAGCCCTTGTGTGGATCAGCTGAAAAA - UNI9

521 - AGCTTTAGAAGGTGCAAATTTGCCAGTCACTGAGACCTCAACTGGTATCTGTCAATCAGAAAATGGGGACAGCTCTGCACTATCAA - UNI95

21 - ACTCAGGATCAGGTGCAGTATCACCTTATGAAGAAGAACGATGTCAACAAGTCTCTGCTACAA TACTTACCAATCACCAACATTTAGAGAAAAC

ACCACTGTGTGCCATCTTGACGCAAAAAGCTCCTCAACAATATCGAGTCCGCGCCAAACTGAGATCCTATTTGCCCAGGAGACTTTCCCAGTCTGTTAAA

CTTCTCTGTCCTAAATGTCATTCAGT ACAAGAAGTTCCACATGGGGACAGTTTGGATAAAATTTTGCAAGATGCTGCAACTGAAGCTCCAGACATCAAG

CTGAAAGCGACATCATTGTATTATTCAAAAGTCTGGACCACTGAAGACCAGGGCGGACGGCAGGTCGCTGTTCATTTTGTGAAAAATAATGGCATTCTCC

CTGCTTCAAGTGAATGTCTAATTTTGATAGAAG GAGGAAGGCTCTGCGAAGTCTCTAAACTGTCCAGCAAGTTCCACAGTGTGATGCCTGTGCGGTCCG

GCCCTGAGAGCCTGGAGCTCCTTACCCTTTCAGCCCCGTTCCTCATACAGGGAAAGGTGCATCACTATGG ATGTAAACAGTGCTCAAGCTTGAAACCTA

TACAAAATCTAAACTCCCGTTTTCATAAAGGACCGTGGACTCCTTCCTCTGTGGCAGAAG CCCTGGGCGTTGTGCCGCTGCAGTATGTGTTTGTTATGG

TTTTCACTCTGGATGACGGGACAGGGGTGTTGGAAGCTTACCTCAAGGATTCT GAACACTTTTTCAAGATCCCAGCATCTGAAGTCCTCACTGATGACG

ACCTTCAGAGAAGTCTAGAAACGATCATGGATATGATATGTCCCCCAGGAATAAAAGTTG ATGCATACCCATGGCTAGAGTGCCTCCTCAAGTCCTACA

ATGTCACCATCGGAACAGAGCGACGAATTTGCTACCAGATTTTTGATACTACAGTTGCAGAAAATGTTGTCTAGTACTGCCATTGAGTGCAGTGTGTATG

GGATTTTACAGTTTTAGAAAAGATCATGACTCTTTGAGATTCCCAGAAGACATTTTGCTATTGTGAAAAAGTGTTTTATCCTTTTTCACTATAGTTTAGT

AATTTGTACAGAAAAATATTTTATTGTTATTTATGCTGTCTTGTGAACATATCAAAAATCCCTTGTTGCTCATCATGTCGTGGGAGGTACAAAATGAGGC

AGCACTGGTTGGGGAGAACCAGGCTTTCTTGGCTCTCATTTATAAAACACTGGGAGCTGATTTTACTTCTGTGCTGTTTGATGTTTGGGTTTTTGTTGTT

GTTGTTGTTGTTTGTTTTGTTTTGTTTTTTATACCGAAGAATCTGCTTAGCAACTTCTGAACGGATTCTCCCTCTGCATCCACACATGAGTATCAGGTTA

ACTGCGTGCCGGTTGAACAGATGCTTGTCTCGGTGAGCCTGGCTGTACTGATGTACTTTCAGAAGACGTATGGTTTATTTGGGTGCTCTGGTCGCCCACT

TTAGCGTAAGTGTAGCTCTGTGAACCGAAGAGTATGCCTGACCTTCAGCATTTCTCTACAACATTAGAAGTTGCTTCATTGCCCACCAGCGAATAAAGTG

ATGAGATTTATGATTTTTGTGTCTGTGTGTGTGTGTGAATCATCTGTATCTTCTCTTTTTTGGTAGTCTTATGTAAAGTATTCCCGTATTGCATTATTGA

GGTCTTAGCACAATTGAATGTTCTGCATTTTTTTCAACAGTGTTTATCAATTTGCATGGGCTTTTATTTTTGAAAAAGAAATATTTTGTACAATATAGTT

TGATGAATTTTCTGTTCC
Translation
 - UNI17561 -  - UNI22924 -  MSL VSTAPYTYTPLNLLKEGTIANVYGVVKFFKPPYVSKGTD DYCSVVTIVDQTNVKLTCMLFSGNYEA

LPIIYKVGDIVRFHRLK IQVYKNELQGINCSGFASLTFEGTVGMPVTARTSSKVFSFTPQDQKMVEALRVWASKHISASSTLVQLCDAQPMQYYDLTCQ

LLGKAQVDSTAFLLK VWDGTQTVLPSWRVSTQDLTFEGDLSHIERLQSLVVDILVYDNHVQVARSIE VGCFLRLYSLHTKLQPGNSETSSSESLRLEF

HLHGGTSYGRGIRVLPDTSPCVDQLKK - UNI9521 - KALEGANLPVTETSTGICQSENGDSSALSN - UNI9521 - NSGSGAVSPYEEERCQQ

VSATI ILTNHQHLEKTPLCAILTQKAPQQYRVRAKLRSYLPRRLSQSVKLLCPKCHSV VQEVPHGDSLDKILQDAATEAPDIKLKATSLYYSKVWTTE

DQGGRQVAVHFVKNNGILPASSECLILIEG GGRLCEVSKLSSKFHSVMPVRSGPESLELLTLSAPFLIQGKVHHYG GCKQCSSLKPIQNLNSRFHKGP

WTPSSVAEA ALGVVPLQYVFVMVFTLDDGTGVLEAYLKDS EHFFKIPASEVLTDDDLQRSLETIMDMICPPGIKVD DAYPWLECLLKSYNVTIGTER

RICYQIFDTTVAENVV

For any suggestions or comments, please send an email to unitrap@crg.es