Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029699 (Srcrb4d)
Chromosomal location
Chr 5: 136436081 - 136450401 (-)
Description
scavenger receptor cysteine rich domain containing, group B (4 domains) Gene [Source:MGI (curated);Acc:Srcrb4d-002]
UniGene
Mm.332750 
MGI
MGI:1924709 
Uniprot/SWISSPROT
A1L0T3 
Uniprot/SPTREMBL
Q8BUS2 
Human Ortholog
ENSG00000146700 (SRCRB4D)
Omim not available
UniTrap UNI32127
Vector Insertion
Chr 5: 136446051 - 136450368
Public Clones IST14603F4 (tigm) IST10448F1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35062
Vector Insertion
Chr 5: 136440488 - 136441756
Public Clones IST13915G1 (tigm) IST11265A10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36567
Vector Insertion
Chr 5: 136439225 - 136440567
Public Clones IST13043H6 (tigm) IST11118C4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36247
Vector Insertion
Chr 5: 136438792 - 136439301
Public Clones IST12588F11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34100
Vector Insertion
Chr 5: 136438069 - 136439105
Public Clones IST10393B4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14680
Vector Insertion
Chr 5: 136437758 - 136438142
Public Clones FHCRC-GT-S1-8D1 (fhcrc) PST19416-NR (escells)
Private Clones OST425677 (lexicon) OST291584 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33389
Vector Insertion
Chr 5: 136436093 - 136437837
Public Clones IST11789G8 (tigm) IST12262G11 (tigm) IST12389B6 (tigm) IST11988B6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19912
Vector Insertion
Chr 5: 136436092 - 136437079
Public Clones not available
Private Clones OST377414 (lexicon) OST301604 (lexicon) OST295116 (lexicon)
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111153
Sequence
TCCTCCGGGGCTGCTCACCACACTGCGGACCACTTCCACTGTCCCTTAGCCTCTCTGCCCCCAAGGTCAGGTGGGGACAGGCTGGGGCCACCGGCAGCTC

CATGGCCAAGGACACTGCCTCTTCTCTCCTTCTAGCTACGGAAAGAAAAGAAGAAAAGTCTGTGCTGATCTGTATCTCGGGGGCCCTTCCCCCTCCTAAA

GTCCCTGGAGCAGAGGCAGTGATTGAAACTTGGATTATCTGGAGGGAAAGAACCCAGAACATCCCTACAG - UNI32127 - ATGTTCCAGCTGTGAC

TTCTCCTCAGATTCTTGATGGGACCGTCGGAAAGGCCATCCATTGGCTGGACACCCAAGGAAGCAGAGATGCAAATTGGCCCCCAGCCTGATGGATGGAG

CAGGGGATGGAAGCCTGGGGACAGGGGTGCTGTCCCCCTGCCCCTCTCCCCAGCACTGTCCTTCCTCCTTCTGTTCCCACTGG - UNI32127 - CCA

GTGCCCTCCAGCCCACTCCGCTGCCCTTTCCAG AACTGAGGCTGGTAGGGGGCCCGAGCCGCTGCCGAGGGCGCCTCGAGGTCATGCATAGCGGCTCCT

GGGGCAGCGTTTGCGACGATGACTGGGACGTTGTAGATGCTAACGTGGTGTGTCGTCAGCTGGGCTGTGGCCTGGCATTGCCGGTGCCACGGCCCCTCGC

CTTTGGCCAGGGCAGAGGGCCCATTTTCCTGGATAATGTGGAGTGCCGCGGGCAGGAAGCGTCTCTGAGCGAGTGTGGCAGCAGGGGCTGGGGTGTCCAC

AACTGCTTTCACTATGAAGATGTGGCAGTCCTGTGTGATG AATTCTTGCACACACAGCCCCCAACAAGGAAGGTGTTAACCAGTATGGCACCCGCTACA

GCCCTCCAAAATGGAAAAG - UNI35062 - GTGAGGGCAGTGTGCGTCTGGTGGGCGGCGCCAGCCCGTGTCAAGGCCGAGTGGAGATTCTGCATGG

TGGCGTCTGGGGCACTGTATGCGACGATGACTGGGGGCTGCAGGATGCTGCTGTTGTGTGCCGCCAGCTGGGCTGTGGGGTCGCCTTGGCCGCCACCACT

AATGCCTTTTTCGGCTATGGTACCGGGCATATCCTGCTGGACAATGTTCACTGCGAAGGTGGCGAGCCCCGCCTGGCAGCCTGCCAGAGCCTAGGCTGGG

GCGTGCACAACTGCGGACACCACGAGGATGCTGGGGTGCTCTGTGCAG - UNI35062 - - UNI36567 - TTCTAAGCCCTCCGACTTCCACAGC

TCTGCCTCCGTCTGTCACAAAAGAAGACTGGGCACGGCACACTGGGCCAGCAG - UNI35062 - - UNI36247 - - UNI36567 - CTACAGG

AGTTGGTGCCTCACCTTCCAGGGACACTGTGTGGCTGACGACAGCAGCCCGGGCCTCAGGGAAGAAAA - UNI34100 - - UNI36247 - - UNI

36567 - GCGGAAGGCTGAGGCTGGTCGGGGGCCCGAGCCCGTGCCGCGGCCGCGTGGAGGTGCTGTACGCCGGGGGTTGGGGCACCGTGTGCGACGAT

GACTGGGACTTCGCGGACGCGCGGGTGGCCTGTCGCGAGGCGGGTTGCGGGCCCGCGCTAGGCGCCACGGGCCTTGGTCATTTTGGCTATGGCCGAGGCC

CTGTGCTGCTAGACAACGTAGGCTGCACCGGTACTGAGGCCCGCCTCAGCGACTGCTTCCATCTGGGCTGGGGACAGCACAACTGCGGCCACCACGAAGA

CGCCGGAGCGCTTTGTGCAG - UNI14680 - - UNI33389 - - UNI34100 - - UNI36247 - GCCCAGAGGAACTGGGACTCCAAGTCC

AGCAGGCTGGTTCTGAGACCACCCGAATGCCCAGTCCTCGGCCCAGAGATG - UNI14680 - - UNI19912 - - UNI33389 - GGCACCTCC

GTCTGGCTAGTGGAACACACCGATGTGAGGGGCGCGTAGAACTCTTCCTAGGACAACGGTGGGGCACTGTTTGTGATGATGCCTGGGACCTACGGGCAGC

CATTGTCCTGTGCCGTCAGCTGGGATGTGGCCAGGCTCTCGCAGCCCCGGGAGAGGCCCACTTTGGCCCAGGCCGAGGCCCAATCCTCTTGGACAATGTC

AAATGCCGAGGAGATGAGAGCACCTTGCTACTGTGCTCTCATATCCGCTGGGATGTCCACAACTGTGACCACAGCGAGGATGCCAGTGTCTTGTGCCAGC

CATTGTGACCCAGATGGCTCTGTACTCCATACCATATCAAAGGAGCCTATGAGGAACTGCCTGTCCTTTCCCAGGATGCCTTCCTATGATAGCTCGGGTT

CCTGGTACCCCTTTCTCCCCGTGCATGGGAGAGATGCAGTACCTGCCCGAGTCCTCTTACTGTGTGTCCCGAGACTGTTATCACCTGCGGAAGGCCCAAT

ACAGTGAACATAGCAATGTTTTGCTCAGCCAAATCAGAAAATGTGAGAGAATAACCCACTTCTCTTTGGGGGAACTCATATAGTACCCCCAATCCTTCCC

TTCTGCACCCACATCCATGAGGCTTGGGCTGTCTGTAAATGCCTTCAAACCCTTACCGTGACCTCTCTTGGTCTCCTGCTAAAAGTGGGGAGACAAAGGG

GTTGGGGTGCTCTTTTCTATAGACTGGCAGGGGACTGCAGAAGAACCAGGCCATCACCTTCCCTGCTGGGTGAGGACCTGGACTCAGATGGTGCTCCGCT

GAACAAGGGGGCTGCAGGGGCCAAAACAGGGACCAGAGGAGCCCTTCCTGCAGCTTCTCTGATTTCCACTGCCCCCCCCCCCCCAGCACAGAGCCTCCAT

TTTGCAGTAACAAAGAACCCTGGAGGCCCATAGCCACTGTCCTTAGGTGCCAAGTCAATAAAGCATTATCTCCCCCAGTCTTTTAACTG
Translation
 - UNI32127 - MGPSERPSIGWTPKEAEMQIGPQPDGWSRGWKPGDRGAVPLPLSPALSFLLLFPLA - UNI32127 - ASALQPTPLPFPE EL

RLVGGPSRCRGRLEVMHSGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPRPLAFGQGRGPIFLDNVECRGQEASLSECGSRGWGVHNCFHYEDVAVLCD

E EFLHTQPPTRKVLTSMAPATALQNGKG - UNI35062 - GEGSVRLVGGASPCQGRVEILHGGVWGTVCDDDWGLQDAAVVCRQLGCGVALAATTN

AFFGYGTGHILLDNVHCEGGEPRLAACQSLGWGVHNCGHHEDAGVLCAV - UNI35062 - - UNI36567 - VLSPPTSTALPPSVTKEDWARHTG

PAA - UNI35062 - - UNI36247 - - UNI36567 - ATGVGASPSRDTVWLTTAARASGKKS - UNI34100 - - UNI36247 - - UN

I36567 - SGRLRLVGGPSPCRGRVEVLYAGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVLLDNVGCTGTEARLSDCFHLGWGQH

NCGHHEDAGALCAG - UNI14680 - - UNI33389 - - UNI34100 - - UNI36247 - GPEELGLQVQQAGSETTRMPSPRPRDG - UNI

14680 - - UNI19912 - - UNI33389 - GHLRLASGTHRCEGRVELFLGQRWGTVCDDAWDLRAAIVLCRQLGCGQALAAPGEAHFGPGRGPIL

LDNVKCRGDESTLLLCSHIRWDVHNCDHSEDASVLCQPL
Transcript ENSMUST00000111152
Sequence
TCCACTGTCCCTTAGCCTCTCTGCCCCCAAGGTCAGGTGGGGACAGGCTGGGGCCACCGGCAGCTCCATGGCCAAGGACACTGCCTCTTCTCTCCTTCTA

GCTACGGAAAGAAAAGAAGAAAAGTCTGTGCTGATCTGTATCTCGGGGGCCCTTCCCCCTCCTAAAGTCCCTGGAGCAGAGGCAGTGATTGAAACTTGGA

TTATCTGGAGGGAAAGAACCCAGAACATCCCTACAG - UNI32127 - CTGGCCCAGGCAGCTGGAAGTAAACACGCAGGACCTTGAGTCACAGATGT

TCCAGCTGTGACTTCTCCTCAGATTCTTGATGGGACCGTCGGAAAGGCCATCCATTGGCTGGACACCCAAGGAAGCAGAGATGCAAATTGGCCCCCAGCC

TGATGGATGGAGCAGGGGATGGAAGCCTGGGGACAGGGGTGCTGTCCCCCTGCCCCTCTCCCCAGCACTGTCCTTCCTCCTTCTGTTCCCACTGG - UN

I32127 - CCAGTGCCCTCCAGCCCACTCCGCTGCCCTTTCCAG AACTGAGGCTGGTAGGGGGCCCGAGCCGCTGCCGAGGGCGCCTCGAGGTCATGC

ATAGCGGCTCCTGGGGCAGCGTTTGCGACGATGACTGGGACGTTGTAGATGCTAACGTGGTGTGTCGTCAGCTGGGCTGTGGCCTGGCATTGCCGGTGCC

ACGGCCCCTCGCCTTTGGCCAGGGCAGAGGGCCCATTTTCCTGGATAATGTGGAGTGCCGCGGGCAGGAAGCGTCTCTGAGCGAGTGTGGCAGCAGGGGC

TGGGGTGTCCACAACTGCTTTCACTATGAAGATGTGGCAGTCCTGTGTGATG AATTCTTGCACACACAGCCCCCAACAAGGAAGGTGTTAACCAGTATG

GCACCCGCTACAGCCCTCCAAAATGGAAAAG - UNI35062 - GTGAGGGCAGTGTGCGTCTGGTGGGCGGCGCCAGCCCGTGTCAAGGCCGAGTGGA

GATTCTGCATGGTGGCGTCTGGGGCACTGTATGCGACGATGACTGGGGGCTGCAGGATGCTGCTGTTGTGTGCCGCCAGCTGGGCTGTGGGGTCGCCTTG

GCCGCCACCACTAATGCCTTTTTCGGCTATGGTACCGGGCATATCCTGCTGGACAATGTTCACTGCGAAGGTGGCGAGCCCCGCCTGGCAGCCTGCCAGA

GCCTAGGCTGGGGCGTGCACAACTGCGGACACCACGAGGATGCTGGGGTGCTCTGTGCAG - UNI35062 - - UNI36567 - TTCTAAGCCCTCC

GACTTCCACAGCTCTGCCTCCGTCTGTCACAAAAGAAGACTGGGCACGGCACACTGGGCCAGCAG - UNI35062 - - UNI36247 - - UNI365

67 - CTACAGGAGTTGGTGCCTCACCTTCCAGGGACACTGTGTGGCTGACGACAGCAGCCCGGGCCTCAGGGAAGAAAA - UNI34100 - - UNI3

6247 - - UNI36567 - GCGGAAGGCTGAGGCTGGTCGGGGGCCCGAGCCCGTGCCGCGGCCGCGTGGAGGTGCTGTACGCCGGGGGTTGGGGCACC

GTGTGCGACGATGACTGGGACTTCGCGGACGCGCGGGTGGCCTGTCGCGAGGCGGGTTGCGGGCCCGCGCTAGGCGCCACGGGCCTTGGTCATTTTGGCT

ATGGCCGAGGCCCTGTGCTGCTAGACAACGTAGGCTGCACCGGTACTGAGGCCCGCCTCAGCGACTGCTTCCATCTGGGCTGGGGACAGCACAACTGCGG

CCACCACGAAGACGCCGGAGCGCTTTGTGCAG - UNI14680 - - UNI33389 - - UNI34100 - - UNI36247 - GCCCAGAGGAACTGG

GACTCCAAGTCCAGCAGGCTGGTTCTGAGACCACCCGAATGCCCAGTCCTCGGCCCAGAGATG - UNI14680 - - UNI19912 - - UNI33389

 - GGCACCTCCGTCTGGCTAGTGGAACACACCGATGTGAGGGGCGCGTAGAACTCTTCCTAGGACAACGGTGGGGCACTGTTTGTGATGATGCCTGGGA

CCTACGGGCAGCCATTGTCCTGTGCCGTCAGCTGGGATGTGGCCAGGCTCTCGCAGCCCCGGGAGAGGCCCACTTTGGCCCAGGCCGAGGCCCAATCCTC

TTGGACAATGTCAAATGCCGAGGAGATGAGAGCACCTTGCTACTGTGCTCTCATATCCGCTGGGATGTCCACAACTGTGACCACAGCGAGGATGCCAGTG

TCTTGTGCCAGCCATTGTGACCCAGATGGCTCTGTACTCCATACCATATCAAAGGAGCCTATGAGGAACTGCCTGTCCTTTCCCAGGATGCCTTCCTATG

ATAGCTCGGGTTCCTGGTACCCCTTTCTCCCCGTGCATGGGAGAGATGCAGTACCTGCCCGAGTCCTCTTACTGTGTGTCCCGAGACTGTTATCACCTGC

GGAAGGCCCAATACAGTGAACATAGCAATGTTTTGCTCAGCCAAATCAGAAAATGTGAGAGAATAACCCACTTCTCTTTGGGGGAACTCATATAGTACCC

CCAATCCTTCCCTTCTGCACCCACATCCATGAGGCTTGGGCTGTCTGTAAATGCCTTCAAACCCTTACCGTGACCTCTCTTGGTCTCCTGCTAAAAGTGG

GGAGACAAAGGGGTTGGGGTGCTCTTTTCTATAGACTGGCAGGGGACTGCAGAAGAACCAGGCCATCACCTTCCCTGCTGGGTGAGGACCTGGACTCAGA

TGGTGCTCCGCTGAACAAGGGGGCTGCAGGGGCCAAAACAGGGACCAGAGGAGCCCTTCCTGCAGCTTCTCTGATTTCCACTGCCCCCCCCCCCCCAGCA

CAGAGCCTCCATTTTGCAGTAACAAAGAACCCTGGAGGCCCATAGCCACTGTCCTTAGGTGCCAAGTCAATAAAGCATTATCTCCCCCA
Translation
 - UNI32127 - MGPSERPSIGWTPKEAEMQIGPQPDGWSRGWKPGDRGAVPLPLSPALSFLLLFPLA - UNI32127 - ASALQPTPLPFPE EL

RLVGGPSRCRGRLEVMHSGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPRPLAFGQGRGPIFLDNVECRGQEASLSECGSRGWGVHNCFHYEDVAVLCD

E EFLHTQPPTRKVLTSMAPATALQNGKG - UNI35062 - GEGSVRLVGGASPCQGRVEILHGGVWGTVCDDDWGLQDAAVVCRQLGCGVALAATTN

AFFGYGTGHILLDNVHCEGGEPRLAACQSLGWGVHNCGHHEDAGVLCAV - UNI35062 - - UNI36567 - VLSPPTSTALPPSVTKEDWARHTG

PAA - UNI35062 - - UNI36247 - - UNI36567 - ATGVGASPSRDTVWLTTAARASGKKS - UNI34100 - - UNI36247 - - UN

I36567 - SGRLRLVGGPSPCRGRVEVLYAGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVLLDNVGCTGTEARLSDCFHLGWGQH

NCGHHEDAGALCAG - UNI14680 - - UNI33389 - - UNI34100 - - UNI36247 - GPEELGLQVQQAGSETTRMPSPRPRDG - UNI

14680 - - UNI19912 - - UNI33389 - GHLRLASGTHRCEGRVELFLGQRWGTVCDDAWDLRAAIVLCRQLGCGQALAAPGEAHFGPGRGPIL

LDNVKCRGDESTLLLCSHIRWDVHNCDHSEDASVLCQPL
Transcript ENSMUST00000111151
Sequence
CAGAACTGAGGCTGGTAGGGGGCCCGAGCCGCTGCCGAGGGCGCCTCGAGGTCATGCATAGCGGCTCCTGGGGCAGCGTTTGCGACGATGACTGGGACGT

TGTAGATGCTAACGTGGTGTGTCGTCAGCTGGGCTGTGGCCTGGCATTGCCGGTGCCACGGCCCCTCGCCTTTGGCCAGGGCAGAGGGCCCATTTTCCTG

GATAATGTGGAGTGCCGCGGGCAGGAAGCGTCTCTGAGCGAGTGTGGCAGCAGGGGCTGGGGTGTCCACAACTGCTTTCACTATGAAGATGTGGCAGTCC

TGTGTGATG AATTCTTGCACACACAGCCCCCAACAAGGAAGGTGTTAACCAGTATGGCACCCGCTACAGCCCTCCAAAATGGAAAAG - UNI35062 

- GTGAGGGCAGTGTGCGTCTGGTGGGCGGCGCCAGCCCGTGTCAAGGCCGAGTGGAGATTCTGCATGGTGGCGTCTGGGGCACTGTATGCGACGATGAC

TGGGGGCTGCAGGATGCTGCTGTTGTGTGCCGCCAGCTGGGCTGTGGGGTCGCCTTGGCCGCCACCACTAATGCCTTTTTCGGCTATGGTACCGGGCATA

TCCTGCTGGACAATGTTCACTGCGAAGGTGGCGAGCCCCGCCTGGCAGCCTGCCAGAGCCTAGGCTGGGGCGTGCACAACTGCGGACACCACGAGGATGC

TGGGGTGCTCTGTGCAG - UNI35062 - - UNI36567 - TTCTAAGCCCTCCGACTTCCACAGCTCTGCCTCCGTCTGTCACAAAAGAAGACTGG

GCACGGCACACTGGGCCAGCAG - UNI35062 - - UNI36247 - - UNI36567 - CTACAGGAGTTGGTGCCTCACCTTCCAGGGACACTGTG

TGGCTGACGACAGCAGCCCGGGCCTCAGGGAAGAAAA - UNI34100 - - UNI36247 - - UNI36567 - GCGGAAGGCTGAGGCTGGTCGGG

GGCCCGAGCCCGTGCCGCGGCCGCGTGGAGGTGCTGTACGCCGGGGGTTGGGGCACCGTGTGCGACGATGACTGGGACTTCGCGGACGCGCGGGTGGCCT

GTCGCGAGGCGGGTTGCGGGCCCGCGCTAGGCGCCACGGGCCTTGGTCATTTTGGCTATGGCCGAGGCCCTGTGCTGCTAGACAACGTAGGCTGCACCGG

TACTGAGGCCCGCCTCAGCGACTGCTTCCATCTGGGCTGGGGACAGCACAACTGCGGCCACCACGAAGACGCCGGAGCGCTTTGTGCAG - UNI14680

 - - UNI33389 - - UNI34100 - - UNI36247 - GCCCAGAGGAACTGGGACTCCAAGTCCAGCAGGCTGGTTCTGAGACCACCCGAATGCC

CAGTCCTCGGCCCAGAGATG - UNI14680 - - UNI19912 - - UNI33389 - GGCACCTCCGTCTGGCTAGTGGAACACACCGATGTGAGGG

GCGCGTAGAACTCTTCCTAGGACAACGGTGGGGCACTGTTTGTGATGATGCCTGGGACCTACGGGCAGCCATTGTCCTGTGCCGTCAGCTGGGATGTGGC

CAGGCTCTCGCAGCCCCGGGAGAGGCCCACTTTGGCCCAGGCCGAGGCCCAATCCTCTTGGACAATGTCAAATGCCGAGGAGATGAGAGCACCTTGCTAC

TGTGCTCTCATATCCGCTGGGATGTCCACAACTGTGACCACAGCGAGGATGCCAGTGTCTTGTGCCAGCCATTGTGACCCAGATGGCTCTGTACTCCATA

CCATATCAAAGGAGCCTATGAGGAACTGCCTGTCCTTTCCCAGGATGCCTTCCTATGATAGCTCGGGTTCCTGGTACCCCTTTCTCCCCGTGCATGGGAG

AGATGCAGTACCTGCCCGAGTCCTCTTACTGTGTGTCCCGAGACTGTTATCACCTGCGGAAGGCCCAATACAGT
Translation
ELRLVGGPSRCRGRLEVMHSGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPRPLAFGQGRGPIFLDNVECRGQEASLSECGSRGWGVHNCFHYEDVAVL

CDE EFLHTQPPTRKVLTSMAPATALQNGKG - UNI35062 - GEGSVRLVGGASPCQGRVEILHGGVWGTVCDDDWGLQDAAVVCRQLGCGVALAAT

TNAFFGYGTGHILLDNVHCEGGEPRLAACQSLGWGVHNCGHHEDAGVLCAV - UNI35062 - - UNI36567 - VLSPPTSTALPPSVTKEDWARH

TGPAA - UNI35062 - - UNI36247 - - UNI36567 - ATGVGASPSRDTVWLTTAARASGKKS - UNI34100 - - UNI36247 - - 

UNI36567 - SGRLRLVGGPSPCRGRVEVLYAGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVLLDNVGCTGTEARLSDCFHLGWG

QHNCGHHEDAGALCAG - UNI14680 - - UNI33389 - - UNI34100 - - UNI36247 - GPEELGLQVQQAGSETTRMPSPRPRDG - U

NI14680 - - UNI19912 - - UNI33389 - GHLRLASGTHRCEGRVELFLGQRWGTVCDDAWDLRAAIVLCRQLGCGQALAAPGEAHFGPGRGP

ILLDNVKCRGDESTLLLCSHIRWDVHNCDHSEDASVLCQPL
Transcript ENSMUST00000054895
Sequence
TCAAGGGAGCACTCGTGCTGTGCTATCCAATTTATAGTCTCTGCTGCTAGTGATTGGTAGGAAGCAGGAGTGGCTGACGGCTTTCCCAAAACTAGCCTTT

GACTTTTCAGAGATACCAATGAAAACAG - UNI14680 - - UNI33389 - - UNI34100 - GCCCAGAGGAACTGGGACTCCAAGTCCAGCAG

GCTGGTTCTGAGACCACCCGAATGCCCAGTCCTCGGCCCAGAGATG - UNI14680 - - UNI19912 - - UNI33389 - GGCACCTCCGTCTG

GCTAGTGGAACACACCGATGTGAGGGGCGCGTAGAACTCTTCCTAGGACAACGGTGGGGCACTGTTTGTGATGATGCCTGGGACCTACGGGCAGCCATTG

TCCTGTGCCGTCAGCTGGGATGTGGCCAGGCTCTCGCAGCCCCGGGAGAGGCCCACTTTGGCCCAGGCCGAGGCCCAATCCTCTTGGACAATGTCAAATG

CCGAGGAGATGAGAGCACCTTGCTACTGTGCTCTCATATCCGCTGGGATGTCCACAACTGTGACCACAGCGAGGATGCCAGTGTCTTGTGCCAGCCATTG

TGACCCAGATGGCTCTGTACTCCATACCATATCAAAGGAGCCTATGAGGAACTGCCTGTCCTTTCCCAGGATGCCTTCCTATGATAGCTCGGGTTCCTGG

TACCCCTTTCTCCCCGTGCATGGGAGAGATGCAGTACCTGCCCGAGTCCTCTTACTGTGTGTCCCGAGACTGTTATCACCTGCGGAAGGCCCAATACAGT

GAACATAGCAATGTTTTGCTCAGCCAAATCAGAAAATGTGAGAGAATAACCCACTTCTCTTTGGGGGAACTCATATAGTACCCCCAATCCTTCCCTTCTG

CACCCACATCCATGAGGCTTGGGCTGTCTGTAAATGCCTTCAAACCCTTACCGTGACCTCTCTTGGTCTCCTGCTAAAAGTGGGGAGACAAAGGGGTTGG

GGTGCTCTTTTCTATAGACTGGCAGGGGACTGCAGAAGAACCAGGCCATCACCTTCCCTGCTGGGTGAGGACCTGGACTCAGATGGTGCTCCGCTGAACA

AGGGGGCTGCAGGGGCCAAAACAGGGACCAGAGGAGCCCTTCCTGCAGCTTCTCTGATTTCCACTGCCCCCCCCCCCCCAGCACAGAGCCTCCATTTTGC

AGTAACAAAGAACCCTGGAGGCCCATAGCCACTGTCCTTAGGTGCCAAGTCAATAAAGCATTATCTCCCCC
Translation
MKTG - UNI14680 - - UNI33389 - - UNI34100 - GPEELGLQVQQAGSETTRMPSPRPRDG - UNI14680 - - UNI19912 - - 

UNI33389 - GHLRLASGTHRCEGRVELFLGQRWGTVCDDAWDLRAAIVLCRQLGCGQALAAPGEAHFGPGRGPILLDNVKCRGDESTLLLCSHIRWDV

HNCDHSEDASVLCQPL
Transcript ENSMUST00000111150
Sequence
GTAGGAAGCAGGAGTGGCTGACGGCTTTCCCAAAACTAGCCTTTGACTTTTCAGAGATACCAATGAAAACAG - UNI14680 - - UNI19912 - -

 UNI33389 - - UNI34100 - GGCACCTCCGTCTGGCTAGTGGAACACACCGATGTGAGGGGCGCGTAGAACTCTTCCTAGGACAACGGTGGGGCA

CTGTTTGTGATGATGCCTGGGACCTACGGGCAGCCATTGTCCTGTGCCGTCAGCTGGGATGTGGCCAGGCTCTCGCAGCCCCGGGAGAGGCCCACTTTGG

CCCAGGCCGAGGCCCAATCCTCTTGGACAATGTCAAATGCCGAGGAGATGAGAGCACCTTGCTACTGTGCTCTCATATCCGCTGGGATGTCCACAACTGT

GACCACAGCGAGGATGCCAGTGTCTTGTGCCAGCCATTGTGACCCAGATGGCTCTGTACTCCATACCATATCAAAGGAGCCTATGAGGAACTGCCTGTCC

TTTCCCAGGATG
Translation
MKTG - UNI14680 - - UNI19912 - - UNI33389 - - UNI34100 - GHLRLASGTHRCEGRVELFLGQRWGTVCDDAWDLRAAIVLCRQ

LGCGQALAAPGEAHFGPGRGPILLDNVKCRGDESTLLLCSHIRWDVHNCDHSEDASVLCQPL

For any suggestions or comments, please send an email to unitrap@crg.es