Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029718 (Pcolce)
Chromosomal location
Chr 5: 138046335 - 138052632 (-)
Description
procollagen C-endopeptidase enhancer protein Gene [Source:MGI (curated);Acc:Pcolce-001]
RefSeq_dna
NM_008788 
RefSeq_peptide
NP_032814.2 
MGI
MGI:105099 
Uniprot/SWISSPROT
Q61398 
Uniprot/SPTREMBL
Q3TX39 Q3UIP2 Q3UN82 
Human Ortholog
ENSG00000106333 (PCOLCE)
Omim not available
UniTrap UNI13005
Vector Insertion
Chr 5: 138051734 - 138052464
Public Clones CMHD-GT_348G1-3 (cmhd) CMHD-GT_410H5-3 (cmhd) IST12454G9 (tigm) IST13072D4 (tigm)
IST11113A9 (tigm) IST14837F4 (tigm)
Private Clones OST292749 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13189
Vector Insertion
Chr 5: 138050378 - 138051624
Public Clones CMHD-GT_452H5-3 (cmhd) CMHD-GT_323E7-3 (cmhd) CMHD-GT_298H4-3 (cmhd) IST11368B6 (tigm)
IST11369H1 (tigm) IST12537H8 (tigm)
Private Clones OST370935 (lexicon) OST145764 (lexicon) OST120801 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21689
Vector Insertion
Chr 5: 138049308 - 138049844
Public Clones not available
Private Clones OST321010 (lexicon)
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23094
Vector Insertion
Chr 5: 138048773 - 138049182
Public Clones not available
Private Clones OST276662 (lexicon) OST256277 (lexicon) OST252718 (lexicon) OST148094 (lexicon)
OST106827 (lexicon) OST100993 (lexicon)
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28190
Vector Insertion
Chr 5: 138047029 - 138048054
Public Clones not available
Private Clones OST37642 (lexicon)
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000031731
Sequence
ATCCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGAACTCAGCTGCTGCTTCCAGCACTTCCCCCCTACACAATGCTGCCTGCTGCCCTAACCTCC

TTTCTGGGGCCATTCCTTTTGGCCTGGGTGCTGCCTCTTGCCCGAGGCCAGACCCCCAACTACACGAG - UNI13005 - ACCTGTGTTCCTGTGCGG

AGGGGACGTGACCGGGGAGTCAGGTTACGTGGCAAGTGAGGGTTTCCCCAACCTCTACCCCCCAAACAAGAAGTGCATCTGGACAATTACG - UNI131

89 - GTGCCCGAGGGCCAGACTGTGTCCCTGTCCTTCCGAGTCTTCGATATGGAGCTCCACCCTTCCTGCCGCTACGATGCTCTGGAGGTCTTTGCTGG

CTCTGGCACCTCAGGCCAGCGACTTGGACGCTTCTGCGGCACCTTCAGGCCTGCACCTGTAGTCGCACCTGGCAACCAAGTGACTTTAAGGATGACAACT

GACGAGGGCACCGGGGGACGAGGCTTCCTGCTCTGGTACAGCGGCCGGGCCACTTCGGGCACTG - UNI21689 - AGCACCAGTTTTGTGGGGGGCG

GATGGAGAAGGCGCAGGGAACCTTGACCACGCCCAACTGGCCTGAGTCGGATTACCCACCAGGCATCAGCTGTTCCTGGCACATCATTGCACCCTCAAAC

CAG - UNI23094 - GTGATCATGCTAACCTTTGGGAAGTTTGATGTGGAGCCTGACACGTACTGCCGATATGACTCTGTCAGTGTGTTTAACGGAGC

TGTGAGTGACGACTCAAAGAGGCTGGGGAAATTTTGCGGAGACAAGGCCCCTAG CCCCATCTCTTCTGAAGGGAACGAGCTCCTGGTCCAGTTTGTATC

AGATCTCAGTGTCACCGCAGATGGCTTCTCAGCCTCCTACAGGACCCTGCCACGGGATGCCGTAGAGAAGGAGTCAGCCCTGAGTCCAGGGGAGGACGTA

CAGCGTGGTCCCCAGTCCCGCTCTGACCCTAAGACAGGAACTGGGCCCAAAGTCAAACCACCCACTAAACCTAAATCCCAACCTGCAGAGACACCAGAGG

CTTCCCCTGCTACCCAGGCAACCCCAGTGGCCCCAG - UNI28190 - CTGCCCCCAGCATCACCTGCCCAAAGCAGTACAAGCGGTCAGGCACCTTG

CAGAGCAACTTCTGTTCCAGTAGCCTAG TGGTGACAGGAACAGTGAAGACCATGGTCCGGGGCCCCGGGGAAGGCCTCACTGTCACTGTCAGTCTCCTT

GGTGTCTACAAAACCGGAGGACTGGACCTGCCCTCTCCGCCCAGTGGCACCTCTCTGAAGTTGTATGTGCCCTGCAGGCAGATGCCCCCCATGAAGAAAG

 GAGCCAGTTATCTGCTGATGGGTCAGGTGGAAGAAAACAGAGGCCCCATCCTTCCTCCAGAGAGCTTCGTGGTTCTCTACAGGTCCAACCAGGACCAGA

TCCTCAATAACCTAAGCAAGAGGAAGTGTCCCTCCCAACCTAGGACAGCTGCCTGATGTCCTAGCCAGATACAGCCTCAGAGCTCATCCAAATAAATGTT

TCTTGACTCAGG
Translation
MLPAALTSFLGPFLLAWVLPLARGQTPNYTR - UNI13005 - RPVFLCGGDVTGESGYVASEGFPNLYPPNKKCIWTIT - UNI13189 - VPEG

QTVSLSFRVFDMELHPSCRYDALEVFAGSGTSGQRLGRFCGTFRPAPVVAPGNQVTLRMTTDEGTGGRGFLLWYSGRATSGTE - UNI21689 - EHQ

FCGGRMEKAQGTLTTPNWPESDYPPGISCSWHIIAPSNQ - UNI23094 - VIMLTFGKFDVEPDTYCRYDSVSVFNGAVSDDSKRLGKFCGDKAPS 

SPISSEGNELLVQFVSDLSVTADGFSASYRTLPRDAVEKESALSPGEDVQRGPQSRSDPKTGTGPKVKPPTKPKSQPAETPEASPATQATPVAPA - UN

I28190 - AAPSITCPKQYKRSGTLQSNFCSSSLV VVTGTVKTMVRGPGEGLTVTVSLLGVYKTGGLDLPSPPSGTSLKLYVPCRQMPPMKKG GASY

LLMGQVEENRGPILPPESFVVLYRSNQDQILNNLSKRKCPSQPRTAA
Transcript ENSMUST00000054564
Sequence
TGCTGCTGCTGAACTCAGCTGCTGCTTCCAGCACTTCCCCCCTACACAATGCTGCCTGCTGCCCTAACCTCCTTTCTGGGGCCATTCCTTTTGGCCTGGG

TGCTGCCTCTTGCCCGAGGCCAGACCCCCAACTACACGAG - UNI13005 - ACCTGTGTTCCTGTGCGGAGGGGACGTGACCGGGGAGTCAGGTTAC

GTGGCAAGTGAGGGTTTCCCCAACCTCTACCCCCCAAACAAGAAGTGCATCTGGACAATTACG - UNI13189 - GTGCCCGAGGGCCAGACTGTGTC

CCTGTCCTTCCGAGTCTTCGATATGGAGCTCCACCCTTCCTGCCGCTACGATGCTCTGGAGGTCTTTGCTGGCTCTGGCACCTCAGGCCAGCGACTTGGA

CGCTTCTGCGGCACCTTCAGGCCTGCACCTGTAGTCGCACCTGGCAACCAAGTGACTTTAAGGATGACAACTGACGAGGGCACCGGGGGACGAGGCTTCC

TGCTCTGGTACAGCGGCCGGGCCACTTCGGGCACTG GGCCTCCCCCAGGTGCGAGGCGGAAATGGGTCATGGACCCGCGGGTGGAATGGGCGGCCTGGG

GTTACTGGGACG - UNI21689 - AGCACCAGTTTTGTGGGGGGCGGATGGAGAAGGCGCAGGGAACCTTGACCACGCCCAACTGGCCTGAGTCGGAT

TACCCACCAGGCATCAGCTGTTCCTGGCACATCATTGCACCCTCAAACCAG - UNI23094 - GTGATCATGCTAACCTTTGGGAAGTTTGATGTGGA

GCCTGACACGTACTGCCGATATGACTCTGTCAGTGTGTTTAACGGAGCTGTGAGTGACGACTCAAAGAGGCTGGGGAAATTTTGCGGAGACAAGGCCCCT

AG CCCCATCTCTTCTGAAGGGAACGAGCTCCTGGTCCAGTTTGTATCAGATCTCAGTGTCACCGCAGATGGCTTCTCAGCCTCCTACAGGACCCTGCCA

CGGGATGCCGTAGAGAAGGAGTCAGCCCTGAGTCCAGGGGAGGACGTACAGCGTGGTCCCCAGTCCCGCTCTGACCCTAAGACAGGAACTGGGCCCAAAG

TCAAACCACCCACTAAACCTAAATCCCAACCTGCAGAGACACCAGAGGCTTCCCCTGCTACCCAGGCAACCCCAGTGGCCCCAG - UNI28190 - CT

GCCCCCAGCATCACCTGCCCAAAGCAGTACAAGCGGTCAGGCACCTTGCAGAGCAACTTCTGTTCCAGTAGCCTAG TGGTGACAGGAACAGTGAAGACC

ATGGTCCGGGGCCCCGGGGAAGGCCTCACTGTCACTGTCAGTCTCCTTGGTGTCTACAAAACCGGAGGACTGGACCTGCCCTCTCCGCCCAGTGGCACCT

CTCTGAAGTTGTATGTGCCCTGCAGGCAGATGCCCCCCATGAAGAAAG GAGCCAGTTATCTGCTGATGGGTCAGGTGGAAGAAAACAGAGGCCCCATCC

TTCCTCCAGAGAGCTTCGTGGTTCTCTACAGGTCCAACCAGGACCAGATCCTCAATAACCTAAGCAAGAGGAAGTGTCCCTCCCAACCTAGGACAGCTGC

CTGATGTCCTAGCCAGATACAGCCTCAGAGCTCATCCAAATAAATGTTTCTTGACTCAG
Translation
MLPAALTSFLGPFLLAWVLPLARGQTPNYTR - UNI13005 - RPVFLCGGDVTGESGYVASEGFPNLYPPNKKCIWTIT - UNI13189 - VPEG

QTVSLSFRVFDMELHPSCRYDALEVFAGSGTSGQRLGRFCGTFRPAPVVAPGNQVTLRMTTDEGTGGRGFLLWYSGRATSGTG GPPPGARRKWVMDPRV

EWAAWGYWDE - UNI21689 - EHQFCGGRMEKAQGTLTTPNWPESDYPPGISCSWHIIAPSNQ - UNI23094 - VIMLTFGKFDVEPDTYCRYD

SVSVFNGAVSDDSKRLGKFCGDKAPS SPISSEGNELLVQFVSDLSVTADGFSASYRTLPRDAVEKESALSPGEDVQRGPQSRSDPKTGTGPKVKPPTKP

KSQPAETPEASPATQATPVAPA - UNI28190 - AAPSITCPKQYKRSGTLQSNFCSSSLV VVTGTVKTMVRGPGEGLTVTVSLLGVYKTGGLDLPS

PPSGTSLKLYVPCRQMPPMKKG GASYLLMGQVEENRGPILPPESFVVLYRSNQDQILNNLSKRKCPSQPRTAA

For any suggestions or comments, please send an email to unitrap@crg.es