Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029720 (Lrch4)
Chromosomal location
Chr 5: 138070406 - 138081373 (+)
Description
leucine-rich repeats and calponin homology (CH) domain containing 4 Gene [Source:MGI Symbol;Acc:MGI:1917193]
RefSeq_dna
NM_146164 
RefSeq_peptide
NP_666276.1 
MGI
MGI:1917193 
Uniprot/SWISSPROT
Q921G6 
Uniprot/SPTREMBL
Q6KAP0 Q8C2M4 Q8K381 
Human Ortholog
ENSG00000077454 (LRCH4)
Omim not available
UniTrap UNI679
Vector Insertion
Chr 5: 138070655 - 138074799
Public Clones (sanger) DC0368 (sanger) YHC204 (baygenomics) YHC203 (baygenomics) D158H08 (ggtc)
3SE223C03 (ggtc) W270B07 (ggtc) P100G02 (ggtc) W235F04 (ggtc) E051B09 (ggtc)
5SE223C03 (ggtc) A055F02 (ggtc) PST7842-NR (escells) IST14155C9 (tigm)
IST14649A3 (tigm) IST14886A2 (tigm) IST14462A7 (tigm) IST14119A5 (tigm)
IST14380A3 (tigm)
Private Clones OST422206 (lexicon) OST317851 (lexicon) OST299634 (lexicon) OST283580 (lexicon)
OST248998 (lexicon) OST234009 (lexicon) OST211075 (lexicon) OST206941 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36996
Vector Insertion
Chr 5: 138074945 - 138075076
Public Clones CMHD-GT_537B8-3 (cmhd) CMHD-GT_537B8-5S (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36103
Vector Insertion
Chr 5: 138075204 - 138075371
Public Clones CMHD-GT_518D5-5S (cmhd) IST14562C9 (tigm) IST10843D5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32386
Vector Insertion
Chr 5: 138075478 - 138077966
Public Clones IST12800G10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000031734
Sequence
AGTCAGGCAGGGGGAGCCGCCGAGAGCGGATGGCGGCAGCAGTAGCGGGCCCACTCGCCGCCGGGGGTGAGGAAGCTGCAGCTTCAGTGTCCTTGCCAGG

GTCTCCTGGTCTACCTGGGAGCCGTAGCGCAGAACGAGCCCTAGAGGAGGCTGTGGCCACCGGGACCCTGAACTTGTCCAACCGGCGTTTGAAGCACTTC

CCCCGGGGCGCGGCCCGCAGTTACGACTTGTCAGACATCACCCAGGCTG - UNI679 - ACTTGTCTCGGAACCGGTTTCCCGAGGTGCCTGAGGCAG

CTTGCCAGCTGGTGTCCCTGGAAGGCCTGAGCCTCTACCACAATTGCCTGAAATGCCTGAACCCAGCCTTGGGGAATCTTACAGCCCTCACCTACCTCAA

CCTCAG CCGGAACCAGCTGTCGTCGTTGCCACCCTACATCTGCCAGCTGCCCCTTCGAGTGCTTATCATCAGCAACAACAAGTTAGGAGCCCTGCCTCC

AGACATCAGCACCTTGGGAAGCCTGCGGCAGCTT - UNI36103 - GATGTGAGCAGCAATGAGCTGCAGTCCCTGCCCGTGGAGCTGTGTAGCCTCC

GTTCCCTGCGGGATCTCAATGTTCGAAGGAACCAGCTCAGTACCCTGCCTGATG - UNI32386 - AGCTGGGAGACCTTCCTCTGGTCCGCCTGGAT

TTCTCCTGTAACCGCATCTCCCGAATCCCCGTCTCCTTCTGCCGCCTCAGGCACCTGCAGGTCGTTCTGCTGGATAGCAACCCCCTACAGAGTCCACCTG

CCCAG ATATGCCTGAAGGGGAAACTTCACATCTTCAAGTACCTAACAATGGAAGCTGGCCGGAGGGGAGCCGCCCTCGGGGACCTGGTCCCTTCCCGCC

CCCCAAGTTTTAGTCCTTG CCCTGCCGAAGATTTATTTCCGGGACGTCGTTATGATGGTGGCCTGGACTCAGGCTTCCACAGCGTTGACAGTGGCAGCA

AGAGGTGGTCAGGAAATGAG TCCACAGATGATTTTTCAGAGCTGTCTTTCCGGATCTCGGAGCTGGCTCGTGATCCCCGGGGGCCTAGACAACCTAGGG

AAGATGGCGCTG GCGATGGAGACCTGGAGCAGATTGACTTTATTGACAGCCACGTTCCTGGGGAAGATGAAGATCGAAGTGCAGCTGAG GAGCAGCTG

CCTTCTGAATTAAGCCTTGTAGCAGGGGATGTGGAGAAGCCATCTAGCAGCAG GCGAGAGGAGCCTGCAGGGGAGGAGAGGCGGCGCCCAGACACTTTG

CAGTTGTGGCAGGAACGGGAGCGGAAGCAACAGCAACAGAGTGGGGGATGGGGGTCCCCCAGGAAGGACAG CGTCCTGAAGCGGGGGATCCGAGCTGCC

GGGGCAGGTGCTTCGGCCCCATCCACACAGGCCACCTGCAA TGGCCCACCAAAGTCCAGCACTACCCAACTGGGAGTTTCAGGGGGGCAGGGAGCTCCC

ACACCACCCCCCACCTCCCAGGACCCCCTTCCTGTATCTGGACCAG TGACAGCTCCTGTTCCCAGGCCCCTGGGCTCCATTCAGAGACCAAACAGCTTC

CTCTTCCGGTCCTCTTCTCAGAGTGGCTCTA GTCCTTCCTCTCCAGAGTCTGTTTTGAGACCTCGGCCGTTTCCTCAGGAGAAGGAGCTAATATCCCAA

CTTCGCCAG GTCCTAGAGTCGCGGCTGCAGCAGCCCCTACCTGAGGACCTGGCAGAAGCTCTCGCCAACGGAGTCCTCCTTTGCCAGCTGGCGAACCAG

CTGCGGCCCCGCTCTGTACCCTTCATTCATGTGCCCTCACCTGCTGTG CCAAAGCTCAGTGCTCTCAAGTCTCGGAAGAATGTCGAGAGTTTCCTAGAA

GCCTGTCGGAAAATGGGTGTGCCTGAG GCTGACCTGTGCTCGCCCTCGGATCTCCTCCGGGGCACCGCCCAGGGGCTGCAGACCGTCCTGGAGGCTGTG

ATCCTGGTTGGGGGCAAGGCCCCTCTCCCAGTCCAGCCCTCCTCTGGTCTGGGTGGCTTCCTCCTCTTCTACGTGGTCTTCATGCTGCTGCTCTATGTCG

TCTACACTCGGCTCCTGGGCTCCTAG
Translation
MAAAVAGPLAAGGEEAAASVSLPGSPGLPGSRSAERALEEAVATGTLNLSNRRLKHFPRGAARSYDLSDITQAD - UNI679 - DLSRNRFPEVPEAA

CQLVSLEGLSLYHNCLKCLNPALGNLTALTYLNLS SRNQLSSLPPYICQLPLRVLIISNNKLGALPPDISTLGSLRQL - UNI36103 - DVSSNEL

QSLPVELCSLRSLRDLNVRRNQLSTLPDE - UNI32386 - ELGDLPLVRLDFSCNRISRIPVSFCRLRHLQVVLLDSNPLQSPPAQ ICLKGKLHIF

KYLTMEAGRRGAALGDLVPSRPPSFSPC CPAEDLFPGRRYDGGLDSGFHSVDSGSKRWSGNE STDDFSELSFRISELARDPRGPRQPREDGAG GDGD

LEQIDFIDSHVPGEDEDRSAAE EQLPSELSLVAGDVEKPSSSR RREEPAGEERRRPDTLQLWQERERKQQQQSGGWGSPRKDS SVLKRGIRAAGAGA

SAPSTQATCN NGPPKSSTTQLGVSGGQGAPTPPPTSQDPLPVSGPV VTAPVPRPLGSIQRPNSFLFRSSSQSGSS SPSSPESVLRPRPFPQEKELIS

QLRQ VLESRLQQPLPEDLAEALANGVLLCQLANQLRPRSVPFIHVPSPAV PKLSALKSRKNVESFLEACRKMGVPE ADLCSPSDLLRGTAQGLQTVL

EAVILVGGKAPLPVQPSSGLGGFLLFYVVFMLLLYVVYTRLLGS

For any suggestions or comments, please send an email to unitrap@crg.es