Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029727 (Cyp3a13)
Chromosomal location
Chr 5: 138335405 - 138362847 (-)
Description
cytochrome P450, family 3, subfamily a, polypeptide 13 Gene [Source:MGI (curated);Acc:Cyp3a13]
RefSeq_dna
NM_007819 
RefSeq_peptide
NP_031845.1 
UniGene
Mm.289886 
MGI
MGI:88610 
Uniprot/SWISSPROT
Q64464 
Uniprot/SPTREMBL
Q3UW87 
Human Ortholog
ENSG00000021461 (CYP3A43)
Omim not available
UniTrap UNI17656
Vector Insertion
Chr 5: 138358799 - 138360226
Public Clones not available
Private Clones OST438833 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13483
Vector Insertion
Chr 5: 138335593 - 138336410
Public Clones CMHD-GT_435B4-3 (cmhd) CMHD-GT_277G06-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000031741
Sequence
ACAAACAGCTGGGCAGGGAAGGGAGCTCAGCAGGCTCAGCCCTGAAAGGTGCAGCACACAAAATTGAGAGTACAACTTGGAGAGAGACTTGTTTAAAGAA

AACAGCAATGGACCTGATCCCAAACTTTTCCATGGAAACCTGGATGCTCCTGGCTACCAGCCTGGTCCTTCTCTACTT ATATGGAACTCATTCACATGG

AATTTTTAAAAAGTTGGGAATTCCTGGGCCAAAACCTCTGCCTTTCTTGGGGACGATTCTTGCTTACCAGAAG - UNI17656 - GGCTTCTGGGAAT

GTGACATACAATGTCATAAAAAATATGGGAAAATGTGGGG GTTGTATGACGGTCGACAGCCTGTGCTGGCTATCACAGATCCAGACATAATCAAAACAG

TGCTGGTGAAGGAATGTTACTCTACCTTCACAAACCGGCGG CGCTTTGGTCCAGTGGGTATTTTGAAAAAGGCCATCTCTATCTCTGAGAATGAAGAAT

GGAAGAGAATCCGAGCCCTGCTGTCTCCAACCTTCACCAGTGGGAGGCTCAAGGAG ATGTTCCCCATCATTAACCAGTTTACAGATGTGTTGGTGAGAA

ACATGAGGCAGGGATTAGGAGAAGGAAAGCCCACCAGCATGAAAGA CATCTTTGGGGCCTACAGCATGGATGTGATCACAGCCACCTCATTTGGAGTGA

ATATTGATTCCCTCAACAACCCACAGGATCCTTTTGTGGAGAAAATCAAGAAGCTCTTAAAATTTGATATCTTTGATCCACTGTTCCTCTCAGTGA CAC

TCTTTCCATTCCTTACCCCAGTATTTGATGCACTAAATGTCTCCTTGTTTCCAAGAGATGTCATAAGCTTTTTTACAACTTCAGTAGAACGAATGAAAGA

GAATCGCATGAAAGAGAAAGAAAAG CAAAGAGTGGATTTTCTTCAGCTGATGATAAACTCCCAGAATTACAAAACCAAAGAATCTCATAAAG CATTAT

CTGATGTGGAGATTGTGGCTCAGTCAGTTATCTTTATTTTTGCTGGCTATGAGACCACAAGCAGTGCTCTTTCCTTTGCATTGTATTTGCTGGCCATTCA

CCCTGATGTACAGAAGAAACTTCAGGATGAAATTGATGCGGCTCTGCCCAATAAG GCACCTGCCACCTATGATACCCTGCTACAGATGGAGTATCTAGA

CATGGTGGTGAATGAAACTCTCAGATTATATCCAATCGCTGGAAGACTTGAGAGGGTCTGTAAGACAGATGTTGAAATCAATGGGCTATTCATTCCCAAA

GGGACTGTGGTGATGATACCAACCTTTGCTCTTCACAAAGACCCGAAGTACTGGCCAGAGCCTGAGGAATTCCGCCCTGAAAG GTTCAGCAAGAAGAAT

CAGGACAGCATCAATCCTTACATGTACCTGCCCTTTGGGAGTGGACCAAGGAACTGCATTGGCATGAGGTTTGCTCTCATAAACATGAAAGTTGCTCTTG

TCAGAGTCCTGCAGAACTTCACTGTCCAGCCTTGTAAGGAAACTGAG - UNI13483 - ATCCCTTTAAAATTAAGCAAACAAGGACTTCTTCAACCA

GAAAACCCACTCCTTCTAAAAGTTGTGTCCAGAGATGAGACTGTAAGTGATGAATGAATAATGGTCTGTTATGATGTTGTATCCTGTGGACCAGAAACCA

ATTCATATTGTGAATGAATCCAGAGATAAAGATTGCAATAATTTCGTGC
Translation
MDLIPNFSMETWMLLATSLVLLYL LYGTHSHGIFKKLGIPGPKPLPFLGTILAYQK - UNI17656 - GFWECDIQCHKKYGKMWG GLYDGRQPVL

AITDPDIIKTVLVKECYSTFTNRR RFGPVGILKKAISISENEEWKRIRALLSPTFTSGRLKE MFPIINQFTDVLVRNMRQGLGEGKPTSMKD DIFGA

YSMDVITATSFGVNIDSLNNPQDPFVEKIKKLLKFDIFDPLFLSVT TLFPFLTPVFDALNVSLFPRDVISFFTTSVERMKENRMKEKEK QRVDFLQLM

INSQNYKTKESHKA ALSDVEIVAQSVIFIFAGYETTSSALSFALYLLAIHPDVQKKLQDEIDAALPNK APATYDTLLQMEYLDMVVNETLRLYPIAGR

LERVCKTDVEINGLFIPKGTVVMIPTFALHKDPKYWPEPEEFRPER RFSKKNQDSINPYMYLPFGSGPRNCIGMRFALINMKVALVRVLQNFTVQPCKE

TE - UNI13483 - IPLKLSKQGLLQPENPLLLKVVSRDETVSDE

For any suggestions or comments, please send an email to unitrap@crg.es