Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029729 (Zkscan1)
Chromosomal location
Chr 5: 138526312 - 138549050 (+)
Description
zinc finger with KRAB and SCAN domains 1 Gene [Source:MGI (curated);Acc:Zkscan1-001]
RefSeq_dna
NM_133906 NM_029869 
RefSeq_peptide
NP_084145.1 NP_598667.2 
UniGene
Mm.399654 Mm.213114 
MGI
MGI:1921820 
Uniprot/SWISSPROT
Q8BGS3 
Human Ortholog
ENSG00000106261 (ZKSCAN1)
Omim not available
UniTrap UNI15165
Vector Insertion
Chr 5: 138526460 - 138534147
Public Clones (sanger) D036C06 (ggtc) PST11835-NL (escells) IST14157E10 (tigm) IST14413A11 (tigm)
IST14280C12 (tigm) IST14781D6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24006
Vector Insertion
Chr 5: 138534153 - 138534661
Public Clones not available
Private Clones OST237999 (lexicon) OST209205 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1657
Vector Insertion
Chr 5: 138535368 - 138538294
Public Clones DA0053 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000066617
Sequence
GACCTACTTCCGGTCTTTGTGACTCATTGTGCCTGTGGCGAGGTATTGGGAGGGCCTATGTCGGTGTGCAGTGCCCTTCGGTCGGGTTGAACCCAGAGCA

AGCTGTGCTTGGTCGCCCGGCGTCCCCAGGCCGCTCCGGAGACTCACG - UNI15165 - GAATAGTGGAGGAACCAATAGAAGACAGCTGCTAGGAC

AGAAACTGCAGCCTGACCCTGTTGGACCCCACCAGTTCACTGAGCCTGAATGATGACTGCTGAGTCAAGGGAAACCACAGGTCTATCCCCACAGGCTGCA

CAGGAGAAAGATGGTATAGTTATTGTGAAGGTAGAAGAAGAAGATGAAGAAGACCACATGTGGGGGCAGGACTCTAGCCTGCAGGAGACACCACCACCCG

ACCCAGAGGTATTCCGCCAACGGTTCAGGCGCTTCTGTTACCAGAACACTTTTGGGCCTCGAGAAGCTTTGAATCGACTAAAGGAACTTTGTCATCAGTG

GCTCCGACCAGAAGTCAACAGCAAGGAACAGATCTTGGAGCTGTTGGTACTGGAGCAGTTCCTGTCCATCCTGCCCAAAGAGCTGCAAGTCTGGCTGCAG

GAGTACCGGCCTGACAGTGGGGAAGAGGCCGTGACTCTTCTAGAAGACTTGGAACTTGATCTATCGGGACAGCAG - UNI24006 - GTCCCAGGTCA

AGTTCATGGGCCTGAGATGCTTGCCAGGGGTGTGGTGCCTCTGGATCCAGTTCAGGAGTCCTCAAGCTTTGACCATCATGAAACTGCCCAGTCTCATTTC

AAGCATTCATCTAGGAAGCCTCGTCTCTTATCCCGAG - UNI1657 - GCTCTGAGAACAGGAATGGGAATGAGTCAACCTCAAAGGCTGAAGTCAAA

GAAGATTCCACCTCACATGGGGAGATAGCAGGGAGATTCCAGAAGGAATTTGGAGAGAAACGGGAACAGCAGGGCAGAGTAGTCGAAAGGCAACAGAAAA

ATCCTGAAGAGAAAACTGGCAAAGAAAAGAAAGAGCCTGGGCCACCTACAGCCAAGGAAAAAAAGCCCAGCACAGGAGAGCGGGGCCCGCGGGAGAAGGG

TAAAGGTCTGGGGAGAAGCTTTAGCCTGAGCGCAAACTTTAATAACACCCCAGAGGAGGCTCCGTCGGGAGCAAAGACTCACAGATGCGATGAGTGTGGG

AAATGTTTCACAAGAAGCTCAAGCCTTATCCGCCATAAAATCATCCACACTGGAGAGAAACCCTACGAATGTAACGAGTGTGGCAAAGCCTTCAGTCTCA

ATTCAAACCTTGTCCTTCATCAGCGAATCCACACGGGAGAGAAACCTCATGAATGTAACGAGTGTGGCAAAGCCTTCAGCCATAGCTCAAATCTCATCCT

GCACCAGCGCATCCACTCTGGAGAGAAGCCCTATGAATGTAACGAGTGTGGCAAAGCCTTCAGCCAGAGCTCAGACCTCACGAAGCACCAGAGAATCCAT

ACAGGAGAGAAGCCCTATGAATGTAGCGAATGTGGAAAAGCTTTCAACCGAAACTCATACCTTATTTTGCATCGGAGAATTCACACCCGAGAAAAGCCCT

ACAAGTGCACTAAGTGTGGCAAGGCCTTCACCCGGAGCTCGACCCTCACACTGCACCACAGAATCCATGCCAGAGAGAGAACGTCAGAATACAGCCCAGC

CTCTCTGGATGCCTTTGGGGCATTCCTGAAAAGTTGTGTGTAAAGCAGGAGTGTCTCGTCAAGCCATTTCCCCCCTTTTGTTTCTGGAATTACCTATGTA

CCCATCGAGGGAAAAGTAATAGCACCATCGAATTGTTTGGGAAGTCACACTTCAGGGTCTCTAACAGTTACATCAACCATGTCCTCCCTTCAGGAAGTCT

GTAGACATGCAATTCTTAAAGTCCGTGTAAGGGAAAGCTGGCCGTGTGGATATTCCTGCACTCAAGATAAAAGCATGCACAGTAAACTGTCAAGCTTTCT

AGTCATGGGTATACCTTTAAGGTTTGCTTCCCAGCAACCACACCATATAGTTGATGAGTCAAGATCAGCTCTGTGAATATTATACTGGTTAAGCCACTTG

CTGCAAACAAACCCTAATTAGACAACTTGTATTTCACAATGAAGAGAGATAGTTAATACAAAAACTACATTGGGACATGCTGCTTGAGCAAGTTGTAAAT

CCAGAAGGTTCTATATCTGATCACTGGTAGCCTGCCAAAGCTATAGAAATCTAGGACTGTGTTGGTCAGAATCAAACCAAAGATTTCTATCTCTTTCTGA

AAGAGGGCATATGCACCAGTTTATAGTTCCAAGGACTGTAACAAATGTGGATGGGCCTGCCCCCATCAGTGAGATCAGTCCTACTGAAATAGCAACAATT

CAAGATGCTTCTCTTCCTCTTCAACATCCCTAAAGCACTCTAGAACGCCTAAATGCACTCTCCACAAATTAGCACTTGATTGTATACCATCTTTTCATCC

TTCAGTGTTGGAAGCTTTTATCAATCACCACTCCCCCAAAAAGATGCTTCAGTTGTCAAGAAATATAGTTATGTTCCAGACAGCACAGCACTGGATGTAG

TACTAAACACACACAAGGCACTCCTTAGGACGGACTTCTAACATCACTGTCATATTTGTGGTAGGGTCTGTAAATCATGTGAGTACCTGAACTATGGTAC

CTTCAGACCTACAGGACATGCTATAATGTATTCTGGACTCAATGTTATTTTGTCCTAAGTATAAACAAAGGTTGGTCAGCTACCTGCAGAGACTGCAAAT

ATGGGTCAGTAAGTAAATACCACAGAGTATCAGAAAGGATTCTTGTCATCCACGTACAGAAGAAAACTATGAACACTAACTATGAAGTTTCTGTTTGTGT

GACATCATTCCACAGCAAAGCTCTTGTTCTTGGCCAGAGTTCTTTTCAGTGAGCTGCTAAATGGTGGCATTTTGAGCACTTGCTGAGTTGTTCATCACTT

AGCCAATCCTGTTCAAAAGATGTGAAGGGTTTTTGTTGTTGTTCTTTTGTTTGATTTTTTTTAAAGTTTTTTTTTTTATTTGTTTTATTTCTCAGAGAAA

GGGAAAGTTTAAGGGAGCATTTTTCCTCTCACATTTAACCAGAAACTTGTAGAAGCATCTGTCATCATTAGCCAGCAGTAACTTAAGATGTCCTGTAGCT

CTGAGAAGTTCACCACCACACCAGTGTGGTTGGTTGTGTCACTGTATTTAATAACACACAGTGTCTTTTCTGTTTCTCATGAAAGACTAAAGTGAGGAAG

TGAGGTTAGGGGACTTTAGCCTTTCCTGTCATCTCTGCAGGTGGCTTCCCAGAAGCTCTTGATGGAGACATAACACATACAGGAGACCCCAAGTATCAAG

CTATGCAGGTATTGGGATCTTGAACAGACAGCTTTATTTAAGGAAGCATTGAGATAGTGTGGACAGCCCTACAGAACCCTAGAAACATAAGCTAAAGACA

AACTTGAAGACTGTTGACATGGACACCCCGCCTATGGTTGAGATTTCCCCTCAAGAAACAACTAAAATCACCTTGCACCAGTTGTTCACTGGTGACCAGC

AGCAAAAGTCGGTGAGACACAATAGCAGCAGGTCTCATCAGGTTGGTACCTGTGACCTCTGTTCCAAGTCAGACTAGAATCCTACAAACAATCACTGGTT

CTTGCTTGACTTTATTTCTTAGACCAATCCTAATCTCTGGCGGCATCTGAGCTGTTTGCTTAGTGCTGCCAGTGAGTGTTCTATCCATCCAGCTGAAAAT

CAACAGAGCTACTCTGAGGATTGCACCTGACTCACTTTCTGGAGTGAGGTGGAGATAAAGAGGTGCTTTTTAAGGTTCTCTTAAAGGAATGAGTCATATT

AATGGTGGACTTTTGTGTGAGAGCTCTGGCCTGTTTGGTTTTTTGTCTTGTTTTGTGTTGGGTTTTTTTGTTTTTGTTTTTGTTTTTTTTTTTTTTTAAA

GCAACTGAAATAAGGTACAGGACTCCAGGAGCACATCGAGACACTGGCTTTGATCCCAAGAAAGGACTTTGGTCATTTCCCTTTTGGCTGCTTATACACA

GACAATTAACCACATGCTGGTGCACTTCAGCCGTTATTCTTTGTTCTTAAATGAAATTAAGACTGACCTGTGATCCCATCCCTCATTTGATTTCCATTTT

ACTGGAACGTTTTACTATTAGATAGTCACTGGGATGGCTCCAGATCTTCCATGGATGCAGTCCTGGAGGCAGCCACCTGAAAATACATTTTACTTAGAAA

GCTGACTATAGGTGGTTATCCAAATTTCTTAGATGCTCAGCAGTGTCACTGCATCGTGGTCAAATGTGGTGACATCTGTCGTTAGTGCTCAGGCTAGTTA

ACAGCCTAAGTGCTTATTAGTTAACCATCAGCATGCCGATTGACATGATGGAACTTTAAGACTTCTTAAATGTACTTTACAACAAAAGCCAGATTCTTCA

AGTTTTGAACTTTCTACTTCAGCCTGGCAGGCAAGGCTAAGCATTGATGTGTGAGACAACTTTATATGTAAAGCACTTGATATTAAAGGTATAATCGTGA

GACTGTTAAATATGTGTAGAGAGACTGACATGTTAAATATGTGAGGCAGTCCATGCCTTATATACATCAGAGAATTGATTCCAGAATGGGACCGAGTCCG

AGTGTGATGCCTGGCAAAGGTTACACTGTAAATAAACTCTTTCTGTGAGGCCAGCTTTATGCACTCATTGCTTTGGACAGGAAATTTCCATTGTGCATCT

CAATCATGCCGTAAGTTCAGAAGCTGCCAGAAGAGCTCAGTCTTAACTCCAGAGGACCCACAGGAGAGCCCAAGTGTGGGCAATGCTAAAGAAACAGTAA

AAACTCACAACTTCTTACAAACGGTGAACACTGAGTACCTCGGTGTATTCTGTAAGGTCATAATGTCGGTGTGTCTTTGTACCTCACCCCTCCTGTCATT

CTTTATAGTCCTTGTAAACGTGTTCCAGTCCGTTGAACAGATCCCATCACCTGGGAGCGGGGAGAAAGTGAAGTTTTGGAGTAGTTAAGAAACTATAGTT

ATAAACGTGATTAGGTCTCAGAACTAGGGGTGTGGAAGAAACTTCTTAGGTTGGTGCTTGTTGAACCGAGAAAAGTCTGTGAAAAGAGCTCAGTAGAACA

CTAAAGTGGAATAATTGTACATGCCCCTTCCTGGTCTCTCACTCAAAGGGAATGGGCAGGCTCTGGCTTAGAGGTGGGCTGAGGGCTTCTCCATTGTTAA

TATATTTGGGGGAATATATAATCAACAGAAGCTAGGAAGTATACCGGAAAGGCTAGTTTGTCCAGATTCTTTGAGCCATGGTATCATAGTTCAGTTTTCC

CACTCATAAATCCTCTATGCTTAGACAAATAGGGACTCTGTCCACAGGAAGGACTACTTTCCAGGAAACACAAGTAGGTCTTGCAGGGAAGGGGAGCTAT

CTCAGAGTTTGCAAAGCATTGCAAGATTTGCTTTTGCTTTACTGCAAGTTCCTATCTTTGCTCCCAATCTCTGGTGTATTTGTGCTTAAGAGACAGTGTT

TGAAGATTCGTAGCTGTGAATATTTGTTGATTTAAGATTTTATCTTAGAATTGCCAACTGTATTTCCAGTAGGCAATGCTGATCTGTTATCAAAAGGGAA

TTTAATCAAGCTCATCTTGCCATCCTCCTGGAAGACTAATTTTGTCACTGGAGTGACAATGCTGAGACAGACACTCAAGACAGCAAGCTTGCCACAGAGC

CATTTTCTGTGTTCCACTATGAGCAACTCTCAGAAGTCTGTATGAAGAAGGATTAGGGGTGTGGTTCCATCCCCAGCACTGCATGAAAAGGATGTGCTGT

CACATGCCTGTGATCCCAGCACTTAGGAAGTAGAGGCAAGAAGATCGGGAATTTGGGATCATCCTCTGTGACATAGCAAGTTTGAGACCTGCCTGAACTG

CCAGAGATCTTATCAAAAACAAACAACCCCCCCCCCATAACTATGTATATGTAAGGGAGCCAGGCAAGGTGGTACATTCCTTTAATCCCAGGACTTGGGA

GGCTGGAACAGTTCACAAGTTCACAGCCAGCCTGTTTCCAAAGAAATAGAAATGTGCAGGTATTTCCCATTAGGCCTGTGAATTGTATGAAATATAGAAC

CAGAGAGGCAAACTTAAATGATGTAAATAGATCACTTCATAGAAGTCAGAGTAGATTTTTATTTCAACTACTACTGGAGGCAACGAGCATTGTTGGAAAA

GTTTTCCTAACATAGATCTAGGCTTTGCTCTTAGTATGGAAACACTACTGTAAGTTTTAAAGAAGTTACTTATTTTGCTATTCATATTTTTTTTTATGTC

TGAAAATACCTGACTTAAAACTTTGTAAAACAAACTTGAAGTTATAGGTAAGGTAAGCCATCACCAATACTGCAGGTCAAACATAAGTTTGGGAAATTAT

TTTGATATCCCATAATACTAATGTTCTAGTAGTTTTCTATTAACTGGTTCTGTTTCCTAGTTGATAACCCAATCCCATGTTATCCTATATTAATCTAAAC

AGCAAAATGAAGAGAGTGAAGCTTACTCAGCTCTAAGCTGTGGTTCCAAATGAAAAATGTCACAGTCTGCTATGAAATTAAGAATTGATTTTTTTATTTT

TGTTTAACCTGGGAGGTTGTGATACACCCCCTTACAAAAACTGACTCAATTTACTTAACTGACCCAAATTACTTGATCATTAGCCAAATTAATTGATCCT

TGAAATGGTCTCAGTTCATAAGCACTCAGGTTTGTGAAGGACTAGAAGAGGCTGGACCTTCATTCCAGTTTGACATTGGGGCTAAGTCCTGTTGGTCCAC

AAAACGACAACCAGTCACACTGAGTCATTTATCCTGTAGTCTCCAGCATGTTACAAGAGAATGGCCAAATGAGGTCTAGCAGCCTCATGATCTGCTAAGA

AAGTGCTGAGGCCAGAGAAGCTTGACTGGGGGGTGGGCAGGTGGTTGCTCACCTTCCTTTCTATCTTAATTGGTAACAGCTTGAAGTGCCAGCCAGCCCT

AGCTGGACTGAGAGTGTGAGACTTGGGCTCAGTTTCTCCTCTGCTCTCAAACCGCCATCCCACAAACATGGATCAAGTAATGCAGTTTCTAGAGCCAGGT

TGGCAGTTTGTAAAGGACTCAATTCAGCTGGTTAAAAGATGCACCAAACCCGACAAAAGAATTCCAGAAGCTTGCCATGGCTACAGCTATAGGATTTGCT

ATCATGAGATTCATTGGCTTCTTCGTGAAACTGATCCATATCCCTATTAATAACATTATCATGGGTGGCTGAGTCCTTTTTCATCATGGGACAAGTGAAC

CAGTGAGGGGGTGACAAGCTCATGAAATAAAACATTGCCTGGAAAAAAAGAGAGAGAGAGACTTACCTGGAATCCCTCAGTGAGGGGTGTGGCTCAGTTA

AGAGCATTTACATAGAGTAACCCATGAAAGTGAATGTGAGTGGCCACAGGACATGGTGCCAAAGCAATAGAGCATTTGCTAGGATACCCTATTAGTGGGT

GGGCTGTGATGTGGCTCCGTGATTGCCTACCATATGCAAGTCCCTTGGGTGCAATCTCCAGCACTGCCCTGCCCTGCCCAAAAAGAGTTCTTACTTTCTC

ACGGGAGGAAGACTGTGATTAAACAGAACATTCTTGTCCTAAGAATTCGAGTGTTAAGGGTTAGGGTGGTTGTGCAAGCAAATTTTTAAGTTGTATTTTT

ATAAACTTTCAGTTAAGGATTATTATTAACAACCAGGTCAACATGATAAGCCTACATTTATATAGAGAGTTAACTCAGGCACTGTCTTTTTGTTCATAGG

CTAGATAAACCATCCTGTTTTATCCATCCCCAGCATATACTAGAATAAATTAGACCCAAAGAAGAAACTTTGTATGCCAGCAGGATTAAAATCATTGCTG

TTAAAAAGTGGAACTTTGATTTGACCAGCCTCTGAAGAGTCCAGATGTTTAGTAGATGTTCAATAAATAATTTTTAAATGGAA
Translation
 - UNI15165 - MMTAESRETTGLSPQAAQEKDGIVIVKVEEEDEEDHMWGQDSSLQETPPPDPEVFRQRFRRFCYQNTFGPREALNRLKELCHQWLR

PEVNSKEQILELLVLEQFLSILPKELQVWLQEYRPDSGEEAVTLLEDLELDLSGQQ - UNI24006 - VPGQVHGPEMLARGVVPLDPVQESSSFDHH

ETAQSHFKHSSRKPRLLSRG - UNI1657 - GSENRNGNESTSKAEVKEDSTSHGEIAGRFQKEFGEKREQQGRVVERQQKNPEEKTGKEKKEPGPPT

AKEKKPSTGERGPREKGKGLGRSFSLSANFNNTPEEAPSGAKTHRCDECGKCFTRSSSLIRHKIIHTGEKPYECNECGKAFSLNSNLVLHQRIHTGEKPH

ECNECGKAFSHSSNLILHQRIHSGEKPYECNECGKAFSQSSDLTKHQRIHTGEKPYECSECGKAFNRNSYLILHRRIHTREKPYKCTKCGKAFTRSSTLT

LHHRIHARERTSEYSPASLDAFGAFLKSCV
Transcript ENSMUST00000019660
Sequence
GACCTACTTCCGGTCTTTGTGACTCATTGTGCCTGTGGCGAGGTATTGGGAGGGCCTATGTCGGTGTGCAGTGCCCTTCGGTCGGGTTGAACCCAGAGCA

AGCTGTGCTTGGTCGCCCGGCGTCCCCAGGCCGCTCCGGAGACTCACG - UNI15165 - GAATAGTGGAGGAACCAATAGAAGACAGCTGCTAGGAC

AGAAACTGCAGCCTGACCCTGTTGGACCCCACCAGTTCACTGAGCCTGAATGATGACTGCTGAGTCAAGGGAAACCACAGGTCTATCCCCACAGGCTGCA

CAGGAGAAAGATGGTATAGTTATTGTGAAGGTAGAAGAAGAAGATGAAGAAGACCACATGTGGGGGCAGGACTCTAGCCTGCAGGAGACACCACCACCCG

ACCCAGAGGTATTCCGCCAACGGTTCAGGCGCTTCTGTTACCAGAACACTTTTGGGCCTCGAGAAGCTTTGAATCGACTAAAGGAACTTTGTCATCAGTG

GCTCCGACCAGAAGTCAACAGCAAGGAACAGATCTTGGAGCTGTTGGTACTGGAGCAGTTCCTGTCCATCCTGCCCAAAGAGCTGCAAGTCTGGCTGCAG

GAGTACCGGCCTGACAGTGGGGAAGAGGCCGTGACTCTTCTAGAAGACTTGGAACTTGATCTATCGGGACAGCAG - UNI24006 - GTCCCAGGTCA

AGTTCATGGGCCTGAGATGCTTGCCAGGGGTGTGGTGCCTCTGGATCCAGTTCAGGAGTCCTCAAGCTTTGACCATCATGAAACTGCCCAGTCTCATTTC

AAGCATTCATCTAGGAAGCCTCGTCTCTTATCCCGAG - UNI1657 - CTCTCCCTGCCACCCATGTTCCTGCCCCTCATCATGAGGGGAATCCCAGA

GACCAGGCGATGGCATCTGCACTATTGACCGCAGATTCCCAG GCAATGGTGAAGATCGAGGACATGGCCGTGTCCCTCATCCTGGAGGAATGGGGATGT

CAGAACCTGGCTCGGAGGAATCTCAATAGGGACAGCAGGCAGATGAATTTGGGGAATGTGTTTTCCCAGG GCTCTGAGAACAGGAATGGGAATGAGTCA

ACCTCAAAGGCTGAAGTCAAAGAAGATTCCACCTCACATGGGGAGATAGCAGGGAGATTCCAGAAGGAATTTGGAGAGAAACGGGAACAGCAGGGCAGAG

TAGTCGAAAGGCAACAGAAAAATCCTGAAGAGAAAACTGGCAAAGAAAAGAAAGAGCCTGGGCCACCTACAGCCAAGGAAAAAAAGCCCAGCACAGGAGA

GCGGGGCCCGCGGGAGAAGGGTAAAGGTCTGGGGAGAAGCTTTAGCCTGAGCGCAAACTTTAATAACACCCCAGAGGAGGCTCCGTCGGGAGCAAAGACT

CACAGATGCGATGAGTGTGGGAAATGTTTCACAAGAAGCTCAAGCCTTATCCGCCATAAAATCATCCACACTGGAGAGAAACCCTACGAATGTAACGAGT

GTGGCAAAGCCTTCAGTCTCAATTCAAACCTTGTCCTTCATCAGCGAATCCACACGGGAGAGAAACCTCATGAATGTAACGAGTGTGGCAAAGCCTTCAG

CCATAGCTCAAATCTCATCCTGCACCAGCGCATCCACTCTGGAGAGAAGCCCTATGAATGTAACGAGTGTGGCAAAGCCTTCAGCCAGAGCTCAGACCTC

ACGAAGCACCAGAGAATCCATACAGGAGAGAAGCCCTATGAATGTAGCGAATGTGGAAAAGCTTTCAACCGAAACTCATACCTTATTTTGCATCGGAGAA

TTCACACCCGAGAAAAGCCCTACAAGTGCACTAAGTGTGGCAAGGCCTTCACCCGGAGCTCGACCCTCACACTGCACCACAGAATCCATGCCAGAGAGAG

AACGTCAGAATACAGCCCAGCCTCTCTGGATGCCTTTGGGGCATTCCTGAAAAGTTGTGTGTAAAGCAGGAGTGTCTCGTCAAGCCATTTCCCCCCTTTT

GTTTCTGGAATTACCTATGTACCCATCGAGGGAAAAGTAATAGCACCATCGAATTGTTTGGGAAGTCACACTTCAGGGTCTCTAACAGTTACATCAACCA

TGTCCTCCCTTCAGGAAGTCTGTAGACATGCAATTCTTAAAGTCCGTGTAAGGGAAAGCTGGCCGTGTGGATATTCCTGCACTCAAGATAAAAGCATGCA

CAGTAAACTGTCAAGCTTTCTAGTCATGGGTATACCTTTAAGGTTTGCTTCCCAGCAACCACACCATATAGTTGATGAGTCAAGATCAGCTCTGTGAATA

TTATACTGGTTAAGCCACTTGCTGCAAACAAACCCTAATTAGACAACTTGTATTTCACAATGAAGAGAGATAGTTAATACAAAAACTACATTGGGACATG

CTGCTTGAGCAAGTTGTAAATCCAGAAGGTTCTATATCTGATCACTGGTAGCCTGCCAAAGCTATAGAAATCTAGGACTGTGTTGGTCAGAATCAAACCA

AAGATTTCTATCTCTTTCTGAAAGAGGGCATATGCACCAGTTTATAGTTCCAAGGACTGTAACAAATGTGGATGGGCCTGCCCCCATCAGTGAGATCAGT

CCTACTGAAATAGCAACAATTCAAGATGCTTCTCTTCCTCTTCAACATCCCTAAAGCACTCTAGAACGCCTAAATGCACTCTCCACAAATTAGCACTTGA

TTGTATACCATCTTTTCATCCTTCAGTGTTGGAAGCTTTTATCAATCACCACTCCCCCAAAAAGATGCTTCAGTTGTCAAGAAATATAGTTATGTTCCAG

ACAGCACAGCACTGGATGTAGTACTAAACACACACAAGGCACTCCTTAGGACGGACTTCTAACATCACTGTCATATTTGTGGTAGGGTCTGTAAATCATG

TGAGTACCTGAACTATGGTACCTTCAGACCTACAGGACATGCTATAATGTATTCTGGACTCAATGTTATTTTGTCCTAAGTATAAACAAAGGTTGGTCAG

CTACCTGCAGAGACTGCAAATATGGGTCAGTAAGTAAATACCACAGAGTATCAGAAAGGATTCTTGTCATCCACGTACAGAAGAAAACTATGAACACTAA

CTATGAAGTTTCTGTTTGTGTGACATCATTCCACAGCAAAGCTCTTGTTCTTGGCCAGAGTTCTTTTCAGTGAGCTGCTAAATGGTGGCATTTTGAGCAC

TTGCTGAGTTGTTCATCACTTAGCCAATCCTGTTCAAAAGATGTGAAGGGTTTTTGTTGTTGTTCTTTTGTTTGATTTTTTTTAAAGTTTTTTTTTTTAT

TTGTTTTATTTCTCAGAGAAAGGGAAAGTTTAAGGGAGCATTTTTCCTCTCACATTTAACCAGAAACTTGTAGAAGCATCTGTCATCATTAGCCAGCAGT

AACTTAAGATGTCCTGTAGCTCTGAGAAGTTCACCACCACACCAGTGTGGTTGGTTGTGTCACTGTATTTAATAACACACAGTGTCTTTTCTGTTTCTCA

TGAAAGACTAAAGTGAGGAAGTGAGGTTAGGGGACTTTAGCCTTTCCTGTCATCTCTGCAGGTGGCTTCCCAGAAGCTCTTGATGGAGACATAACACATA

CAGGAGACCCCAAGTATCAAGCTATGCAGGTATTGGGATCTTGAACAGACAGCTTTATTTAAGGAAGCATTGAGATAGTGTGGACAGCCCTACAGAACCC

TAGAAACATAAGCTAAAGACAAACTTGAAGACTGTTGACATGGACACCCCGCCTATGGTTGAGATTTCCCCTCAAGAAACAACTAAAATCACCTTGCACC

AGTTGTTCACTGGTGACCAGCAGCAAAAGTCGGTGAGACACAATAGCAGCAGGTCTCATCAGGTTGGTACCTGTGACCTCTGTTCCAAGTCAGACTAGAA

TCCTACAAACAATCACTGGTTCTTGCTTGACTTTATTTCTTAGACCAATCCTAATCTCTGGCGGCATCTGAGCTGTTTGCTTAGTGCTGCCAGTGAGTGT

TCTATCCATCCAGCTGAAAATCAACAGAGCTACTCTGAGGATTGCACCTGACTCACTTTCTGGAGTGAGGTGGAGATAAAGAGGTGCTTTTTAAGGTTCT

CTTAAAGGAATGAGTCATATTAATGGTGGACTTTTGTGTGAGAGCTCTGGCCTGTTTGGTTTTTTGTCTTGTTTTGTGTTGGGTTTTTTTGTTTTTGTTT

TTGTTTTTTTTTTTTTTTAAAGCAACTGAAATAAGGTACAGGACTCCAGGAGCACATCGAGACACTGGCTTTGATCCCAAGAAAGGACTTTGGTCATTTC

CCTTTTGGCTGCTTATACACAGACAATTAACCACATGCTGGTGCACTTCAGCCGTTATTCTTTGTTCTTAAATGAAATTAAGACTGACCTGTGATCCCAT

CCCTCATTTGATTTCCATTTTACTGGAACGTTTTACTATTAGATAGTCACTGGGATGGCTCCAGATCTTCCATGGATGCAGTCCTGGAGGCAGCCACCTG

AAAATACATTTTACTTAGAAAGCTGACTATAGGTGGTTATCCAAATTTCTTAGATGCTCAGCAGTGTCACTGCATCGTGGTCAAATGTGGTGACATCTGT

CGTTAGTGCTCAGGCTAGTTAACAGCCTAAGTGCTTATTAGTTAACCATCAGCATGCCGATTGACATGATGGAACTTTAAGACTTCTTAAATGTACTTTA

CAACAAAAGCCAGATTCTTCAAGTTTTGAACTTTCTACTTCAGCCTGGCAGGCAAGGCTAAGCATTGATGTGTGAGACAACTTTATATGTAAAGCACTTG

ATATTAAAGGTATAATCGTGAGACTGTTAAATATGTGTAGAGAGACTGACATGTTAAATATGTGAGGCAGTCCATGCCTTATATACATCAGAGAATTGAT

TCCAGAATGGGACCGAGTCCGAGTGTGATGCCTGGCAAAGGTTACACTGTAAATAAACTCTTTCTGTGAGGCCAGCTTTATGCACTCATTGCTTTGGACA

GGAAATTTCCATTGTGCATCTCAATCATGCCGTAAGTTCAGAAGCTGCCAGAAGAGCTCAGTCTTAACTCCAGAGGACCCACAGGAGAGCCCAAGTGTGG

GCAATGCTAAAGAAACAGTAAAAACTCACAACTTCTTACAAACGGTGAACACTGAGTACCTCGGTGTATTCTGTAAGGTCATAATGTCGGTGTGTCTTTG

TACCTCACCCCTCCTGTCATTCTTTATAGTCCTTGTAAACGTGTTCCAGTCCGTTGAACAGATCCCATCACCTGGGAGCGGGGAGAAAGTGAAGTTTTGG

AGTAGTTAAGAAACTATAGTTATAAACGTGATTAGGTCTCAGAACTAGGGGTGTGGAAGAAACTTCTTAGGTTGGTGCTTGTTGAACCGAGAAAAGTCTG

TGAAAAGAGCTCAGTAGAACACTAAAGTGGAATAATTGTACATGCCCCTTCCTGGTCTCTCACTCAAAGGGAATGGGCAGGCTCTGGCTTAGAGGTGGGC

TGAGGGCTTCTCCATTGTTAATATATTTGGGGGAATATATAATCAACAGAAGCTAGGAAGTATACCGGAAAGGCTAGTTTGTCCAGATTCTTTGAGCCAT

GGTATCATAGTTCAGTTTTCCCACTCATAAATCCTCTATGCTTAGACAAATAGGGACTCTGTCCACAGGAAGGACTACTTTCCAGGAAACACAAGTAGGT

CTTGCAGGGAAGGGGAGCTATCTCAGAGTTTGCAAAGCATTGCAAGATTTGCTTTTGCTTTACTGCAAGTTCCTATCTTTGCTCCCAATCTCTGGTGTAT

TTGTGCTTAAGAGACAGTGTTTGAAGATTCGTAGCTGTGAATATTTGTTGATTTAAGATTTTATCTTAGAATTGCCAACTGTATTTCCAGTAGGCAATGC

TGATCTGTTATCAAAAGGGAATTTAATCAAGCTCATCTTGCCATCCTCCTGGAAGACTAATTTTGTCACTGGAGTGACAATGCTGAGACAGACACTCAAG

ACAGCAAGCTTGCCACAGAGCCATTTTCTGTGTTCCACTATGAGCAACTCTCAGAAGTCTGTATGAAGAAGGATTAGGGGTGTGGTTCCATCCCCAGCAC

TGCATGAAAAGGATGTGCTGTCACATGCCTGTGATCCCAGCACTTAGGAAGTAGAGGCAAGAAGATCGGGAATTTGGGATCATCCTCTGTGACATAGCAA

GTTTGAGACCTGCCTGAACTGCCAGAGATCTTATCAAAAACAAACAACCCCCCCCCCATAACTATGTATATGTAAGGGAGCCAGGCAAGGTGGTACATTC

CTTTAATCCCAGGACTTGGGAGGCTGGAACAGTTCACAAGTTCACAGCCAGCCTGTTTCCAAAGAAATAGAAATGTGCAGGTATTTCCCATTAGGCCTGT

GAATTGTATGAAATATAGAACCAGAGAGGCAAACTTAAATGATGTAAATAGATCACTTCATAGAAGTCAGAGTAGATTTTTATTTCAACTACTACTGGAG

GCAACGAGCATTGTTGGAAAAGTTTTCCTAACATAGATCTAGGCTTTGCTCTTAGTATGGAAACACTACTGTAAGTTTTAAAGAAGTTACTTATTTTGCT

ATTCATATTTTTTTTTATGTCTGAAAATACCTGACTTAAAACTTTGTAAAACAAACTTGAAGTTATAGGTAAGGTAAGCCATCACCAATACTGCAGGTCA

AACATAAGTTTGGGAAATTATTTTGATATCCCATAATACTAATGTTCTAGTAGTTTTCTATTAACTGGTTCTGTTTCCTAGTTGATAACCCAATCCCATG

TTATCCTATATTAATCTAAACAGCAAAATGAAGAGAGTGAAGCTTACTCAGCTCTAAGCTGTGGTTCCAAATGAAAAATGTCACAGTCTGCTATGAAATT

AAGAATTGATTTTTTTATTTTTGTTTAACCTGGGAGGTTGTGATACACCCCCTTACAAAAACTGACTCAATTTACTTAACTGACCCAAATTACTTGATCA

TTAGCCAAATTAATTGATCCTTGAAATGGTCTCAGTTCATAAGCACTCAGGTTTGTGAAGGACTAGAAGAGGCTGGACCTTCATTCCAGTTTGACATTGG

GGCTAAGTCCTGTTGGTCCACAAAACGACAACCAGTCACACTGAGTCATTTATCCTGTAGTCTCCAGCATGTTACAAGAGAATGGCCAAATGAGGTCTAG

CAGCCTCATGATCTGCTAAGAAAGTGCTGAGGCCAGAGAAGCTTGACTGGGGGGTGGGCAGGTGGTTGCTCACCTTCCTTTCTATCTTAATTGGTAACAG

CTTGAAGTGCCAGCCAGCCCTAGCTGGACTGAGAGTGTGAGACTTGGGCTCAGTTTCTCCTCTGCTCTCAAACCGCCATCCCACAAACATGGATCAAGTA

ATGCAGTTTCTAGAGCCAGGTTGGCAGTTTGTAAAGGACTCAATTCAGCTGGTTAAAAGATGCACCAAACCCGACAAAAGAATTCCAGAAGCTTGCCATG

GCTACAGCTATAGGATTTGCTATCATGAGATTCATTGGCTTCTTCGTGAAACTGATCCATATCCCTATTAATAACATTATCATGGGTGGCTGAGTCCTTT

TTCATCATGGGACAAGTGAACCAGTGAGGGGGTGACAAGCTCATGAAATAAAACATTGCCTGGAAAAAAAGAGAGAGAGAGACTTACCTGGAATCCCTCA

GTGAGGGGTGTGGCTCAGTTAAGAGCATTTACATAGAGTAACCCATGAAAGTGAATGTGAGTGGCCACAGGACATGGTGCCAAAGCAATAGAGCATTTGC

TAGGATACCCTATTAGTGGGTGGGCTGTGATGTGGCTCCGTGATTGCCTACCATATGCAAGTCCCTTGGGTGCAATCTCCAGCACTGCCCTGCCCTGCCC

AAAAAGAGTTCTTACTTTCTCACGGGAGGAAGACTGTGATTAAACAGAACATTCTTGTCCTAAGAATTCGAGTGTTAAGGGTTAGGGTGGTTGTGCAAGC

AAATTTTTAAGTTGTATTTTTATAAACTTTCAGTTAAGGATTATTATTAACAACCAGGTCAACATGATAAGCCTACATTTATATAGAGAGTTAACTCAGG

CACTGTCTTTTTGTTCATAGGCTAGATAAACCATCCTGTTTTATCCATCCCCAGCATATACTAGAATAAATTAGACCCAAAGAAGAAACTTTGTATGCCA

GCAGGATTAAAATCATTGCTGTTAAAAAGTGGAACTTTGATTTGACCAGCCTCTGAAGAGTCCAGATGTTTAGTAGATGTTCAATAAATAATTTTTAAAT

GGAA
Translation
 - UNI15165 - MMTAESRETTGLSPQAAQEKDGIVIVKVEEEDEEDHMWGQDSSLQETPPPDPEVFRQRFRRFCYQNTFGPREALNRLKELCHQWLR

PEVNSKEQILELLVLEQFLSILPKELQVWLQEYRPDSGEEAVTLLEDLELDLSGQQ - UNI24006 - VPGQVHGPEMLARGVVPLDPVQESSSFDHH

ETAQSHFKHSSRKPRLLSRA - UNI1657 - ALPATHVPAPHHEGNPRDQAMASALLTADSQ AMVKIEDMAVSLILEEWGCQNLARRNLNRDSRQMN

LGNVFSQG GSENRNGNESTSKAEVKEDSTSHGEIAGRFQKEFGEKREQQGRVVERQQKNPEEKTGKEKKEPGPPTAKEKKPSTGERGPREKGKGLGRSF

SLSANFNNTPEEAPSGAKTHRCDECGKCFTRSSSLIRHKIIHTGEKPYECNECGKAFSLNSNLVLHQRIHTGEKPHECNECGKAFSHSSNLILHQRIHSG

EKPYECNECGKAFSQSSDLTKHQRIHTGEKPYECSECGKAFNRNSYLILHRRIHTREKPYKCTKCGKAFTRSSTLTLHHRIHARERTSEYSPASLDAFGA

FLKSCV
Transcript ENSMUST00000110963
Sequence
GGCGAGGTATTGGGAGGGCCTATGTCGGTGTGCAGTGCCCTTCGGTCGGGTTGAACCCAGAGCAAGCTGTGCTTGGTCGCCCGGCGTCCCCAGGCCGCTC

CGGAGACTCACG - UNI15165 - - UNI24006 - TGGAGGAACCAATAGAAGACAGCTGCTAGGACAGAAACTGCAGCCTGACCCTGTTGGACCC

CACCAGTTCACTGAGCCTGAATGATGACTGCTGAGTCAAGGGAAACCACAGGTCTATCCCCACAGGCTGCACAGGAGAAAGATGGTATAGTTATTGTGAA

GGTAGAAGAAGAAGATGAAGAAGACCACATGTGGGGGCAGGACTCTAGCCTGCAGGAGACACCACCACCCGACCCAGAGGTATTCCGCCAACGGTTCAGG

CGCTTCTGTTACCAGAACACTTTTGGGCCTCGAGAAGCTTTGAATCGACTAAAGGAACTTTGTCATCAGTGGCTCCGACCAGAAGTCAACAGCAAGGAAC

AGATCTTGGAGCTGTTGGTACTGGAGCAGTTCCTGTCCATCCTGCCCAAAGAGCTGCAAGTCTGGCTGCAGGAGTACCGGCCTGACAGTGGGGAAGAGGC

CGTGACTCTTCTAGAAGACTTGGAACTTGATCTATCGGGACAGCAG - UNI24006 - GTCCCAGGTCAAGTTCATGGGCCTGAGATGCTTGCCAGGG

GTGTGGTGCCTCTGGATCCAGTTCAGGAGTCCTCAAGCTTTGACCATCATGAAACTGCCCAGTCTCATTTCAAGCATTCATCTAGGAAGCCTCGTCTCTT

ATCCCGAG - UNI1657 - GCTCTGAGAACAGGAATGGGAATGAGTCAACCTCAAAGGCTGAAGTCAAAGAAGATTCCACCTCACATGGGGAGATAGC

AGGGAGATTCCAGAAGGAATTTGGAGAGAAACGGGAACAGCAGGGCAGAGTAGTCGAAAGGCAACAGAAAAATCCTGAAGAGAAAACTGGCAAAGAAAAG

AAAGAGCCTGGGCCACCTACAGCCAAGGAAAAAAAGCCCAGCACAGGAGAGCGGGGCCCGCGGGAGAAGGGTAAAGGTCTGGGGAGAAGCTTTAGCCTGA

GCGCAAACTTTAATAACACCCCAGAGGAGGCTCCGTCGGGAGCAAAGACTCACAGATGCGATGAGTGTGGGAAATGTTTCACAAGAAGCTCAAGCCTTAT

CCGCCATAAAATCATCCACACTGGAGAGAAACCCTACGAATGTAACGAGTGTGGCAAAGCCTTCAGTCTCAATTCAAACCTTGTCCTTCATCAGCGAATC

CACACGGGAGAGAAACCTCATGAATGTAACGAGTGTGGCAAAGCCTTCAGCCATAGCTCAAATCTCATCCTGCACCAGCGCATCCACTCTGGAGAGAAGC

CCTATGAATGTAACGAGTGTGGCAAAGCCTTCAGCCAGAGCTCAGACCTCACGAAGCACCAGAGAATCCATACAGGAGAGAAGCCCTATGAATGTAGCGA

ATGTGGAAAAGCTTTCAACCGAAACTCATACCTTATTTTGCATCGGAGAATTCACACCCGAGAAAAGCCCTACAAGTGCACTAAGTGTGGCAAGGCCTTC

ACCCGGAGCTCGACCCTCACACTGCACCACAGAATCCATGCCAGAGAGAGAACGTCAGAATACAGCCCAGCCTCTCTGGATGCCTTTGGGGCATTCCTGA

AAAGTTGTGTGTAAAGCAGGAGTGTCTCGTCAAGCCATTTCCCCCCTTTTGTTTCTGGAATTACCTATGTACCCATCGAGGGAAAAGTAATAGCACCATC

GAATTGTTTGGGAAGTCACACTTCAGGGTCTCTAACAGTTACATCAACCATGTCCTCCCTTCAGGAAGTCTGTAGACATGCAATTCTTAAAGTCCGTGTA

AGGGAAAGCTGGCCGTGTGGATATTCCTGCACTCAAGATAAAAGCATGCACAGTAAACTGTCAAGCTTTCTAGTCATGGGTATACCTTTAAGGTTTGCTT

CCCAGCAACCACACCATATAGTTGATGAGTCAAGATCAGCTCTGTGAATATTATACTGGTTAAGCCACTTGCTGCAAACAAACCCTAATTAGACAACTTG

TATTTCACAATGAAGAGAGATAGTTAATACAAAAACTACATTGGGACATGCTGCTTGAGCAAGTTGTAAATCCAGAAGGTTCTATATCTGATCACTGGTA

GCCTGCCAAAGCTATAGAAATCTAGGACTGTGTTGGTCAGAATCAAACCAAAGATTTCTATCTCTTTCTGAAAGAGGGCATATGCACCAGTTTATAGTTC

CAAGGACTGTAACAAATGTGGATGGGCCTGCCCCCATCAGTGAGATCAGTCCTACTGAAATAGCAACAATTCAAGATGCTTCTCTTCCTCTTCAACATCC

CTAAAGCACTCTAGAACGCCTAAATGCACTCTCCACAAATTAGCACTTGATTGTATACCATCTTTTCATCCTTCAGTGTTGGAAGCTTTTATCAATCACC

ACTCCCCCAAAAAGATGCTTCAGTTGTCAAGAAATATAGTTATGTTCCAGACAGCACAGCACTGGATGTAGTACTAAACACACACAAGGCACTCCTTAGG

ACGGACTTCTAACATCACTGTCATATTTGTGGTAGGGTCTGTAAATCATGTGAGTACCTGAACTATGGTACCTTCAGACCTACAGGACATGCTATAATGT

ATTCTGGACTCAATGTTATTTTGTCCTAAGTATAAACAAAGGTTGGTCAGCTACCTGCAGAGACTGCAAATATGGGTCAGTAAGTAAATACCACAGAGTA

TCAGAAAGGATTCTTGTCATCCACGTACAGAAGAAAACTATGAACACTAACTATGAAGTTTCTGTTTGTGTGACATCATTCCACAGCAAAGCTCTTGTTC

TTGGCCAGAGTTCTTTTCAGTGAGCTGCTAAATGGTGGCATTTTGAGCACTTGCTGAGTTGTTCATCACTTAGCCAATCCTGTTCAAAAGATGTGAAGGG

TTTTTGTTGTTGTTCTTTTGTTTGATTTTTTTTAAAGTTTTTTTTTTTATTTGTTTTATTTCTCAGAGAAAGGGAAAGTTTAAGGGAGCATTTTTCCTCT

CACATTTAACCAGAAACTTGTAGAAGCATCTGTCATCATTAGCCAGCAGTAACTTAAGATGTCCTGTAGCTCTGAGAAGTTCACCACCACACCAGTGTGG

TTGGTTGTGTCACTGTATTTAATAACACACAGTGTCTTTTCTGTTTCTCATGAAAGACTAAAGTGAGGAAGTGAGGTTAGGGGACTTTAGCCTTTCCTGT

CATCTCTGCAGGTGGCTTCCCAGAAGCTCTTGATGGAGACATAACACATACAGGAGACCCCAAGTATCAAGCTATGCAGGTATTGGGATCTTGAACAGAC

AGCTTTATTTAAGGAAGCATTGAGATAGTGTGGACAGCCCTACAGAACCCTAGAAACATAAGCTAAAGACAAACTTGAAGACTGTTGACATGGACACCCC

GCCTATGGTTGAGATTTCCCCTCAAGAAACAACTAAAATCACCTTGCACCAGTTGTTCACTGGTGACCAGCAGCAAAAGTCGGTGAGACACAATAGCAGC

AGGTCTCATCAGGTTGGTACCTGTGACCTCTGTTCCAAGTCAGACTAGAATCCTACAAACAATCACTGGTTCTTGCTTGACTTTATTTCTTAGACCAATC

CTAATCTCTGGCGGCATCTGAGCTGTTTGCTTAGTGCTGCCAGTGAGTGTTCTATCCATCCAGCTGAAAATCAACAGAGCTACTCTGAGGATTGCACCTG

ACTCACTTTCTGGAGTGAGGTGGAGATAAAGAGGTGCTTTTTAAGGTTCTCTTAAAGGAATGAGTCATATTAATGGTGGACTTTTGTGTGAGAGCTCTGG

CCTGTTTGGTTTTTTGTCTTGTTTTGTGTTGGGTTTTTTTGTTTTTGTTTTTGTTTTTTTTTTTTTTTAAAGCAACTGAAATAAGGTACAGGACTCCAGG

AGCACATCGAGACACTGGCTTTGATCCCAAGAAAGGACTTTGGTCATTTCCCTTTTGGCTGCTTATACACAGACAATTAACCACATGCTGGTGCACTTCA

GCCGTTATTCTTTGTTCTTAAATGAAATTAAGACTGACCTGTGATCCCATCCCTCATTTGATTTCCATTTTACTGGAACGTTTTACTATTAGATAGTCAC

TGGGATGGCTCCAGATCTTCCATGGATGCAGTCCTGGAGGCAGCCACCTGAAAATACATTTTACTTAGAAAGCTGACTATAGGTGGTTATCCAAATTTCT

TAGATGCTCAGCAGTGTCACTGCATCGTGGTCAAATGTGGTGACATCTGTCGTTAGTGCTCAGGCTAGTTAACAGCCTAAGTGCTTATTAGTTAACCATC

AGCATGCCGATTGACATGATGGAACTTTAAGACTTCTTAAATGTACTTTACAACAAAAGCCAGATTCTTCAAGTTTTGAACTTTCTACTTCAGCCTGGCA

GGCAAGGCTAAGCATTGATGTGTGAGACAACTTTATATGTAAAGCACTTGATATTAAAGGTATAATCGTGAGACTGTTAAATATGTGTAGAGAGACTGAC

ATGTTAAATATGTGAGGCAGTCCATGCCTTATATACATCAGAGAATTGATTCCAGAATGGGACCGAGTCCGAGTGTGATGCCTGGCAAAGGTTACACTGT

AAATAAACTCTTTCTGTGAGGCCA
Translation
 - UNI15165 - - UNI24006 - MMTAESRETTGLSPQAAQEKDGIVIVKVEEEDEEDHMWGQDSSLQETPPPDPEVFRQRFRRFCYQNTFGPREA

LNRLKELCHQWLRPEVNSKEQILELLVLEQFLSILPKELQVWLQEYRPDSGEEAVTLLEDLELDLSGQQ - UNI24006 - VPGQVHGPEMLARGVVP

LDPVQESSSFDHHETAQSHFKHSSRKPRLLSRG - UNI1657 - GSENRNGNESTSKAEVKEDSTSHGEIAGRFQKEFGEKREQQGRVVERQQKNPEE

KTGKEKKEPGPPTAKEKKPSTGERGPREKGKGLGRSFSLSANFNNTPEEAPSGAKTHRCDECGKCFTRSSSLIRHKIIHTGEKPYECNECGKAFSLNSNL

VLHQRIHTGEKPHECNECGKAFSHSSNLILHQRIHSGEKPYECNECGKAFSQSSDLTKHQRIHTGEKPYECSECGKAFNRNSYLILHRRIHTREKPYKCT

KCGKAFTRSSTLTLHHRIHARERTSEYSPASLDAFGAFLKSCV
Transcript ENSMUST00000110962
Sequence
GTGGTTTTCTCCTTTATTTTTAGAAACATTCTTAGCATCTTCATGTGTATCCTTATATGAAGGGTTAGTAGCACGGGTCACTTTGTATGGGCCCTACATA

CAGGGCCAGAAGGCAGCCTGGGGTGTTTGCTAGTCCTCGGGTGCTGTCTACTTTGGTCTTCCACTCGCCCAGAGCTTACGGAGAGTGCTAGACTGGCAGG

CCTGTGAGCCTAGGGATCCACTATTTTCTGCTCCCTGGTAAATTTTTTATTAATTCTCCCCCCTTCCCCCTTAACTTCAGGAATAGTGGAGGAACCAATA

GAAGACAGCTGCTAGGACAGAAACTGCAGCCTGACCCTGTTGGACCCCACCAGTTCACTGAGCCTGAATGATGACTGCTGAGTCAAGGGAAACCACAGGT

CTATCCCCACAGGCTGCACAGGAGAAAGATGGTATAGTTATTGTGAAGGTAGAAGAAGAAGATGAAGAAGACCACATGTGGGGGCAGGACTCTAGCCTGC

AGGAGACACCACCACCCGACCCAGAGGTATTCCGCCAACGGTTCAGGCGCTTCTGTTACCAGAACACTTTTGGGCCTCGAGAAGCTTTGAATCGACTAAA

GGAACTTTGTCATCAGTGGCTCCGACCAGAAGTCAACAGCAAGGAACAGATCTTGGAGCTGTTGGTACTGGAGCAGTTCCTGTCCATCCTGCCCAAAGAG

CTGCAAGTCTGGCTGCAGGAGTACCGGCCTGACAGTGGGGAAGAGGCCGTGACTCTTCTAGAAGACTTGGAACTTGATCTATCGGGACAGCAG - UNI2

4006 - GTCCCAGGTCAAGTTCATGGGCCTGAGATGCTTGCCAGGGGTGTGGTGCCTCTGGATCCAGTTCAGGAGTCCTCAAGCTTTGACCATCATGAA

ACTGCCCAGTCTCATTTCAAGCATTCATCTAGGAAGCCTCGTCTCTTATCCCGAG - UNI1657 - GCTCTGAGAACAGGAATGGGAATGAGTCAACC

TCAAAGGCTGAAGTCAAAGAAGATTCCACCTCACATGGGGAGATAGCAGGGAGATTCCAGAAGGAATTTGGAGAGAAACGGGAACAGCAGGGCAGAGTAG

TCGAAAGGCAACAGAAAAATCCTGAAGAGAAAACTGGCAAAGAAAAGAAAGAGCCTGGGCCACCTACAGCCAAGGAAAAAAAGCCCAGCACAGGAGAGCG

GGGCCCGCGGGAGAAGGGTAAAGGTCTGGGGAGAAGCTTTAGCCTGAGCGCAAACTTTAATAACACCCCAGAGGAGGCTCCGTCGGGAGCAAAGACTCAC

AGATGCGATGAGTGTGGGAAATGTTTCACAAGAAGCTCAAGCCTTATCCGCCATAAAATCATCCACACTGGAGAGAAACCCTACGAATGTAACGAGTGTG

GCAAAGCCTTCAGTCTCAATTCAAACCTTGTCCTTCATCAGCGAATCCACACGGGAGAGAAACCTCATGAATGTAACGAGTGTGGCAAAGCCTTCAGCCA

TAGCTCAAATCTCATCCTGCACCAGCGCATCCACTCTGGAGAGAAGCCCTATGAATGTAACGAGTGTGGCAAAGCCTTCAGCCAGAGCTCAGACCTCACG

AAGCACCAGAGAATCCATACAGGAGAGAAGCCCTATGAATGTAGCGAATGTGGAAAAGCTTTCAACCGAAACTCATACCTTATTTTGCATCGGAGAATTC

ACACCCGAGAAAAGCCCTACAAGTGCACTAAGTGTGGCAAGGCCTTCACCCGGAGCTCGACCCTCACACTGCACCACAGAATCCATGCCAGAGAGAGAAC

GTCAGAATACAGCCCAGCCTCTCTGGATGCCTTTGGGGCATTCCTGAAAAGTTGTGTGTAAAGCAGGAGTGTCTCGTCAAGCCATTTCCCCCCTTTTGTT

TCTGGAATTACCTATGTACCCATCGAGGGAAAAGTAATAGCACCATCGAATTGTTTGGGAAGTCACACTTCAGGGTCTCTAACAGTTACATCAACCATGT

CCTCCCTTCAGGAAGTCTGTAGACATGCAATTCTTAAAGTCCGTGTAAGGGAAAGCTGGCCGTGTGGATATTCCTGCACTCAAGATAAAAGCATGCACAG

TAAACTGTCAAGCTTTCTAGTCATGGGTATACCTTTAAGGTTTGCTTCCCAGCAACCACACCATATAGTTGATGAGTCAAGATCAGCTCTGTGAATATTA

TACTGGTTAAGCCACTTGCTGCAAACAAACCCTAATTAGACAACTTGTATTTCACAATGAAGAGAGATAGTTAATACAAAAACTACATTGGGACATGCTG

CTTGAGCAAGTTGTAAATCCAGAAGGTTCTATATCTGATCACTGGTAGCCTGCCAAAGCTATAGAAATCTAGGACTGTGTTGGTCAGAATCAAACCAAAG

ATTTCTATCTCTTTCTGAAAGAGGGCATATGCACCAGTTTATAGTTCCAAGGACTGTAACAAATGTGGATGGGCCTGCCCCCATCAGTGAGATCAGTCCT

ACTGAAATAGCAACAATTCAAGATGCTTCTCTTCCTCTTCAACATCCCTAAAGCACTCTAGAACGCCTAAATGCACTCTCCACAAATTAGCACTTGATTG

TATACCATCTTTTCATCCTTCAGTGTTGGAAGCTTTTATCAATCACCACTCCCCCAAAAAGATGCTTCAGTTGTCAAGAAATATAGTTATGTTCCAGACA

GCACAGCACTGGATGTAGTACTAAACACACACAAGGCACTCCTTAGGACGGACTTCTAACATCACTGTCATATTTGTGGTAGGGTCTGTAAATCATGTGA

GTACCTGAACTATGGTACCTTCAGACCTACAGGACATGCTATAATGTATTCTGGACTCAATGTTATTTTGTCCTAAGTATAAACAAAGGTTGGTCAGCTA

CCTGCAGAGACTGCAAATATGGGTCAGTAAGTAAATACCACAGAGTATCAGAAAGGATTCTTGTCATCCACGTACAGAAGAAAACTATGAACACTAACTA

TGAAGTTTCTGTTTGTGTGACATCATTCCACAGCAAAGCTCTTGTTCTTGGCCAGAGTTCTTTTCAGTGAGCTGCTAAATGGTGGCATTTTGAGCACTTG

CTGAGTTGTTCATCACTTAGCCAATCCTGTTCAAAAGATGTGAAGGGTTTTTGTTGTTGTTCTTTTGTTTGATTTTTTTTAAAGTTTTTTTTTTTATTTG

TTTTATTTCTCAGAGAAAGGGAAAGTTTAAGGGAGCATTTTTCCTCTCACATTTAACCAGAAACTTGTAGAAGCATCTGTCATCATTAGCCAGCAGTAAC

TTAAGATGTCCTGTAGCTCTGAGAAGTTCACCACCACACCAGTGTGGTTGGTTGTGTCACTGTATTTAATAACACACAGTGTCTTTTCTGTTTCTCATGA

AAGACTAAAGTGAGGAAGTGAGGTTAGGGGACTTTAGCCTTTCCTGTCATCTCTGCAGGTGGCTTCCCAGAAGCTCTTGATGGAGACATAACACATACAG

GAGACCCCAAGTATCAAGCTATGCAGGTATTGGGATCTTGAACAGACAGCTTTATTTAAGGAAGCATTGAGATAGTGTGGACAGCCCTACAGAACCCTAG

AAACATAAGCTAAAGACAAACTTGAAGACTGTTGACATGGACACCCCGCCTATGGTTGAGATTTCCCCTCAAGAAACAACTAAAATCACCTTGCACCAGT

TGTTCACTGGTGACCAGCAGCAAAAGTCGGTGAGACACAATAGCAGCAGGTCTCATCAGGTTGGTACCTGTGACCTCTGTTCCAAGTCAGACTAGAATCC

TACAAACAATCACTGGTTCTTGCTTGACTTTATTTCTTAGACCAATCCTAATCTCTGGCGGCATCTGAGCTGTTTGCTTAGTGCTGCCAGTGAGTGTTCT

ATCCATCCAGCTGAAAATCAACAGAGCTACTCTGAGGATTGCACCTGACTCACTTTCTGGAGTGAGGTGGAGATAAAGAGGTGCTTTTTAAGGTTCTCTT

AAAGGAATGAGTCATATTAATGGTGGACTTTTGTGTGAGAGCTCTGGCCTGTTTGGTTTTTTGTCTTGTTTTGTGTTGGGTTTTTTTGTTTTTGTTTTTG

TTTTTTTTTTTTTTTAAAGCAACTGAAATAAGGTACAGGACTCCAGGAGCACATCGAGACACTGGCTTTGATCCCAAGAAAGGACTTTGGTCATTTCCCT

TTTGGCTGCTTATACACAGACAATTAACCACATGCTGGTGCACTTCAGCCGTTATTCTTTGTTCTTAAATGAAATTAAGACTGACCTGTGATCCCATCCC

TCATTTGATTTCCATTTTACTGGAACGTTTTACTATTAGATAGTCACTGGGATGGCTCCAGATCTTCCATGGATGCAGTCCTGGAGGCAGCCACCTGAAA

ATACATTTTACTTAGAAAGCTGACTATAGGTGGTTATCCAAATTTCTTAGATGCTCAGCAGTGTCACTGCATCGTGGTCAAATGTGGTGACATCTGTCGT

TAGTGCTCAGGCTAGTTAACAGCCTAAGTGCTTATTAGTTAACCATCAGCATGCCGATTGACATGATGGAACTTTAAGACTTCTTAAATGTACTTTACAA

CAAAAGCCAGATTCTTCAAGTTTTGAACTTTCTACTTCAGCCTGGCAGGCAAGGCTAAGCATTGATGTGTGAGACAACTTTATATGTAAAGCACTTGATA

TTAAAGGTATAATCGTGAGACTGTTAAATATGTGTAGAGAGACTGACATGTTAAATATGTGAGGCAGTCCATGCCTTATATACATCAGAGAATTGATTCC

AGAATGGGACCGAGTCCGAGTGTGATGCCTGGCAAAGGTTACACTGTAAATAAACTCTTTCTGTGAGGCC
Translation
MMTAESRETTGLSPQAAQEKDGIVIVKVEEEDEEDHMWGQDSSLQETPPPDPEVFRQRFRRFCYQNTFGPREALNRLKELCHQWLRPEVNSKEQILELLV

LEQFLSILPKELQVWLQEYRPDSGEEAVTLLEDLELDLSGQQ - UNI24006 - VPGQVHGPEMLARGVVPLDPVQESSSFDHHETAQSHFKHSSRKP

RLLSRG - UNI1657 - GSENRNGNESTSKAEVKEDSTSHGEIAGRFQKEFGEKREQQGRVVERQQKNPEEKTGKEKKEPGPPTAKEKKPSTGERGPR

EKGKGLGRSFSLSANFNNTPEEAPSGAKTHRCDECGKCFTRSSSLIRHKIIHTGEKPYECNECGKAFSLNSNLVLHQRIHTGEKPHECNECGKAFSHSSN

LILHQRIHSGEKPYECNECGKAFSQSSDLTKHQRIHTGEKPYECSECGKAFNRNSYLILHRRIHTREKPYKCTKCGKAFTRSSTLTLHHRIHARERTSEY

SPASLDAFGAFLKSCV

For any suggestions or comments, please send an email to unitrap@crg.es