Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029782 (Tmem209)
Chromosomal location
Chr 6: 30430797 - 30459719 (-)
Description
transmembrane protein 209 Gene [Source:MGI (curated);Acc:Tmem209-004]
RefSeq_dna
NM_178625 
RefSeq_peptide
NP_848740.3 
UniGene
Mm.469619 
MGI
MGI:1919899 
Uniprot/SWISSPROT
Q8BRG8 
Uniprot/SPTREMBL
Q8C214 
Human Ortholog
ENSG00000146842 (TMEM209)
Omim not available
UniTrap UNI17151
Vector Insertion
Chr 6: 30458665 - 30458803
Public Clones not available
Private Clones OST448457 (lexicon) OST392740 (lexicon) OST291512 (lexicon) OST269825 (lexicon)
OST207678 (lexicon) OST162828 (lexicon) OST149033 (lexicon) OST145262 (lexicon)
OST136355 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37602
Vector Insertion
Chr 6: 30458665 - 30459716
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18891
Vector Insertion
Chr 6: 30458513 - 30458665
Public Clones CMHD-GT_429A8-3 (cmhd) (cmhd)
Private Clones OST412226 (lexicon) OST394033 (lexicon) OST182975 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37746
Vector Insertion
Chr 6: 30456785 - 30458513
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15434
Vector Insertion
Chr 6: 30455732 - 30456918
Public Clones PST6687-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30825
Vector Insertion
Chr 6: 30451900 - 30455975
Public Clones IST12690A10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17340
Vector Insertion
Chr 6: 30447994 - 30451900
Public Clones not available
Private Clones OST444616 (lexicon)
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37330
Vector Insertion
Chr 6: 30432986 - 30437374
Public Clones CMHD-GT_445D4-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115157
Sequence
GGCGCGAGTCCACGGCTTCCTGCTGAAGAACATG GCTGTTTTGTTTTTTTGTTTTTTGTTTTGCCTTTGAATAGATGCAAGGAGACGTAAGCCCCAATC

CTTCCCTTATTGACAGAACCATCAAGATGAGAAAAGAAACAGAAACTAGGAAAGTGGTTTTAGCTTGGGGACTCCTAAATGTATCCATGGCTGGAATGAT

ATATACTGAAAT - UNI17151 - - UNI18891 - GACTGGAAAGTTAATCAGTACATATTATAATGTGACATACTGGCCCCTCTGGTATATCG -

 UNI15434 - AACTCGCACTTGCATCGCTCTTCAGTCTTAATGCCTTGTTTGATTTTTGGAGATACTTCAAATATACCGTAGCACCAACAAGTCTGGT

AGTTAGCCCCGGACAGCAAGCACTGTTAGGGTTGAAACAGGCTG - UNI15434 - - UNI30825 - TTGTGCAGACTACACCTCCCCGTGATTTG

GCAGCAACCCAAATCTCTCCATCTCCACCTTCCCCTTCGATTCAAGGTCAAAGTGTGTTAAGTTATAGCCCATCTCGTTCACCCAGTACCAGTCCCAAGT

TTGCCACCAGCTGTATGACTGGGTATAGCCCTCAACTGCAAGGCCTGTCGTCAGGAGGCCTTGGCTCTTACAGCCCTGGTGTGACTTACTCGCCTGTCAG

TGGCTACAATAAG - UNI15434 - - UNI30825 - TTGGCCAGCTTTAGTCTGTCTCCTTCTTCTCCATACCCTACCACTGTGGGCCCAGTGGAG

AGCAGTGGATTGAGAGCTCGCTACCGTTCTCCACCCACGGTCTACAACTCACCCACTGACAAAGAGGACTACATGACAGACCTGAGAACTTTGGACACGT

TCCTTAGAAGTGAGGAAGAGAAACAGCATAGAGTGAAGCTGG - UNI17340 - - UNI30825 - GGAGCCCAGATTCCACCTCTCCTTCTACCAG

CCCTACCTTCTGGAATTACAGTCGTTCTGTGGGTGATTATGCACAAACCTTAAAGAAGTTTCAGTATCAGCTTGCCTGTAGATCACAGGCCCCATGTGCT

AACAAAGATGAAGCCGATCTCATTTCTAAGCAAGCTGCAGAAGAG GTCTGGGCAAGAGTGACTATGAATAGACAGCTTCTCGATCACATGGATTCATGG

ACAGCCAAGTTTAGAAAT TGGATCAGTGAGACAATATTGGTGCCGCTTGTGCAAGAGATTGAGTCTGTCAGCACCCAGATGAGAAGGATGGGCTGTCCA

GAGCTACAAATAGGAG AGGCGAGTGTTACCAGCTTGAAGCAAGCTGCCCTGGTCAGAGCTCCTCTCATTCCAACTCTGAATGCAATTGTGCAGTATTTA

GACCTCACACCAAATCAGGAGTACTTGTTTGAAAGAATCAAAG AACTTTCTCAGGGGGGCTGTATGAGTTCATTCAGATGGAACAGAGGTGGAGACTTC

AAAGGACGCAAATGGGATACAGACCTGCCCACTGATTCTGCT ATCATCATGCATGTGTTTTGCACCTACCTTGATTCCAGATTACCTCCACACCCTAAG

TACCCTGATGGAAAAACATTCACTTCTCAGCACTTCGTTCAGACGCCAAATAAACCAG ATGTTACGAATGAAAATGTGTTTTGTATTTATCAGAGTGCT

GTCAACCCTCCACATTATGAGCTAATCTATCAGCGGCATGTCTACAATCTTCCAAAG GGCAGGAATAATATGTTTCATACGTTGCTGATGTTCCTTTAT

ATCATAAAGACCAAAGAGTCAGGAATGCTTGG GAGAGTTAACCTTGGGCTCTCTGGCGTGAACATTTTGTGGATCTTTGGAGAGTAGTTCCTCATTTAA

TTCCAAACATTTGGACTTTGCTTTTAACTGGTCTGGAAGAAGTTGGAGCTGAGCCCCTCCGAGTGCGCACCTCTTCTGACATAAGATGCATGTTTTGCAG

ACTTGTTAAATTTAACAGGAGACAAGCTGTGGGAGCTTCTTGTGAGCATAGCAAAGCCTGCACCTTCTAGTCCACAGAAAAGCATTACACTGGATGGCTC

TGAGCGAGCTAGTGCCGCTCCCTTCATTTGGTGAGGGCAAGGACGCCTCTCCATTTTAACCCCAGTGAGAACCTGCACCTCATCCTGTACCATCAGAGAC

TGCTTTCATTGTTGGATAGTAGTGTAAGTTCTCAGATGAACCTTGCTAGTTCTCTTTGTTGTATCTTTATATTTCCCCAGTGTTCTACAAGTCAGCCTAA

AGCTGAAATGAAATTAATTTCTAAGTGATGTAGTAATTAATCCTGCTGAGCCATCTCCCCAACCCCCTATTGTTTTTTTTAATATTAAAAGAGATTTGAT

AATA
Translation
 MQGDVSPNPSLIDRTIKMRKETETRKVVLAWGLLNVSMAGMIYTEM - UNI17151 - - UNI18891 - MTGKLISTYYNVTYWPLWYIE - UN

I15434 - ELALASLFSLNALFDFWRYFKYTVAPTSLVVSPGQQALLGLKQAV - UNI15434 - - UNI30825 - VVQTTPPRDLAATQISPSP

PSPSIQGQSVLSYSPSRSPSTSPKFATSCMTGYSPQLQGLSSGGLGSYSPGVTYSPVSGYNK - UNI15434 - - UNI30825 - LASFSLSPSSP

YPTTVGPVESSGLRARYRSPPTVYNSPTDKEDYMTDLRTLDTFLRSEEEKQHRVKLG - UNI17340 - - UNI30825 - GSPDSTSPSTSPTFWN

YSRSVGDYAQTLKKFQYQLACRSQAPCANKDEADLISKQAAEE VWARVTMNRQLLDHMDSWTAKFRN WISETILVPLVQEIESVSTQMRRMGCPELQI

GE EASVTSLKQAALVRAPLIPTLNAIVQYLDLTPNQEYLFERIKE ELSQGGCMSSFRWNRGGDFKGRKWDTDLPTDSA IIMHVFCTYLDSRLPPHPK

YPDGKTFTSQHFVQTPNKPD DVTNENVFCIYQSAVNPPHYELIYQRHVYNLPK GRNNMFHTLLMFLYIIKTKESGMLG GRVNLGLSGVNILWIFGE
Transcript ENSMUST00000102991
Sequence
GCGAGTCCACGGCTTCCTGCTGAAGAACATG - UNI17151 - ATGCAAGGAGACGTAAGCCCCAATCCTTCCCTTATTGACAGAACCATCAAGATGA

GAAAAGAAACAGAAACTAGGAAAGTGGTTTTAGCTTGGGGACTCCTAAATGTATCCATGGCTGGAATGATATATACTGAAAT - UNI17151 - - UN

I18891 - GACTGGAAAGTTAATCAGTACATATTATAATGTGACATACTGGCCCCTCTGGTATATCG - UNI15434 - AACTCGCACTTGCATCGC

TCTTCAGTCTTAATGCCTTGTTTGATTTTTGGAGATACTTCAAATATACCGTAGCACCAACAAGTCTGGTAGTTAGCCCCGGACAGCAAGCACTGTTAGG

GTTGAAACAGGCTG - UNI15434 - - UNI30825 - TTGTGCAGACTACACCTCCCCGTGATTTGGCAGCAACCCAAATCTCTCCATCTCCACCT

TCCCCTTCGATTCAAGGTCAAAGTGTGTTAAGTTATAGCCCATCTCGTTCACCCAGTACCAGTCCCAAGTTTGCCACCAGCTGTATGACTGGGTATAGCC

CTCAACTGCAAGGCCTGTCGTCAGGAGGCCTTGGCTCTTACAGCCCTGGTGTGACTTACTCGCCTGTCAGTGGCTACAATAAG - UNI15434 - - U

NI30825 - TTGGCCAGCTTTAGTCTGTCTCCTTCTTCTCCATACCCTACCACTGTGGGCCCAGTGGAGAGCAGTGGATTGAGAGCTCGCTACCGTTCT

CCACCCACGGTCTACAACTCACCCACTGACAAAGAGGACTACATGACAGACCTGAGAACTTTGGACACGTTCCTTAGAAGTGAGGAAGAGAAACAGCATA

GAGTGAAGCTGG - UNI17340 - - UNI30825 - GGAGCCCAGATTCCACCTCTCCTTCTACCAGCCCTACCTTCTGGAATTACAGTCGTTCTGT

GGGTGATTATGCACAAACCTTAAAGAAGTTTCAGTATCAGCTTGCCTGTAGATCACAGGCCCCATGTGCTAACAAAGATGAAGCCGATCTCATTTCTAAG

CAAGCTGCAGAAGAG GTCTGGGCAAGAGTGACTATGAATAGACAGCTTCTCGATCACATGGATTCATGGACAGCCAAGTTTAGAAAT TGGATCAGTGA

GACAATATTGGTGCCGCTTGTGCAAGAGATTGAGTCTGTCAGCACCCAGATGAGAAGGATGGGCTGTCCAGAGCTACAAATAGGAG AACTTTCTCAGGG

GGGCTGTATGAGTTCATTCAGATGGAACAGAGGTGGAGACTTCAAAGGACGCAAATGGGATACAGACCTGCCCACTGATTCTGCT ATCATCATGCATGT

GTTTTGCACCTACCTTGATTCCAGATTACCTCCACACCCTAAGTACCCTGATGGAAAAACATTCACTTCTCAGCACTTCGTTCAGACGCCAAATAAACCA

G ATGTTACGAATGAAAATGTGTTTTGTATTTATCAGAGTGCTGTCAACCCTCCACATTATGAGCTAATCTATCAGCGGCATGTCTACAATCTTCCAAAG

 GGCAGGAATAATATGTTTCATACGTTGCTGATGTTCCTTTATATCATAAAGACCAAAGAGTCAGGAATGCTTGG GAGAGTTAACCTTGGGCTCTCTGG

CGTGAACATTTTGTGGATCTTTGGAGAGTAGTTCCTCATTTAATTCCAAACATTTGGACTTTGCTTTTAACTGGTCTGGAAGAAGTTGGAGCTGAGCCCC

TCCGAGTGCGCACCTCTTCTGACATAAGATGCATGTTTTGCAGACTTGTTAAATTTAACAG
Translation
M - UNI17151 - MQGDVSPNPSLIDRTIKMRKETETRKVVLAWGLLNVSMAGMIYTEM - UNI17151 - - UNI18891 - MTGKLISTYYNV

TYWPLWYIE - UNI15434 - ELALASLFSLNALFDFWRYFKYTVAPTSLVVSPGQQALLGLKQAV - UNI15434 - - UNI30825 - VVQTT

PPRDLAATQISPSPPSPSIQGQSVLSYSPSRSPSTSPKFATSCMTGYSPQLQGLSSGGLGSYSPGVTYSPVSGYNK - UNI15434 - - UNI30825

 - LASFSLSPSSPYPTTVGPVESSGLRARYRSPPTVYNSPTDKEDYMTDLRTLDTFLRSEEEKQHRVKLG - UNI17340 - - UNI30825 - GS

PDSTSPSTSPTFWNYSRSVGDYAQTLKKFQYQLACRSQAPCANKDEADLISKQAAEE VWARVTMNRQLLDHMDSWTAKFRN WISETILVPLVQEIESV

STQMRRMGCPELQIGE ELSQGGCMSSFRWNRGGDFKGRKWDTDLPTDSA IIMHVFCTYLDSRLPPHPKYPDGKTFTSQHFVQTPNKPD DVTNENVFC

IYQSAVNPPHYELIYQRHVYNLPK GRNNMFHTLLMFLYIIKTKESGMLG GRVNLGLSGVNILWIFGE
Transcript ENSMUST00000115159
Sequence
TGGCGCGAGTCCACGGCTTCCTGCTGAAGAACATG - UNI17151 - ATGCAAGGAGACGTAAGCCCCAATCCTTCCCTTATTGACAGAACCATCAAG

ATGAGAAAAGAAACAGAAACTAGGAAAGTGGTTTTAGCTTGGGGACTCCTAAATGTATCCATGGCTGGAATGATATATACTGAAAT - UNI17151 - 

- UNI18891 - GACTGGAAAGTTAATCAGTACATATTATAATGTGACATACTGGCCCCTCTGGTATATCG - UNI15434 - AACTCGCACTTGCA

TCGCTCTTCAGTCTTAATGCCTTGTTTGATTTTTGGAGATACTTCAAATATACCGTAGCACCAACAAGTCTGGTAGTTAGCCCCGGACAGCAAGCACTGT

TAGGGTTGAAACAGGCTG - UNI15434 - - UNI30825 - TTGTGCAGACTACACCTCCCCGTGATTTGGCAGCAACCCAAATCTCTCCATCTCC

ACCTTCCCCTTCGATTCAAGGTCAAAGTGTGTTAAGTTATAGCCCATCTCGTTCACCCAGTACCAGTCCCAAGTTTGCCACCAGCTGTATGACTGGGTAT

AGCCCTCAACTGCAAGGCCTGTCGTCAGGAGGCCTTGGCTCTTACAGCCCTGGTGTGACTTACTCGCCTGTCAGTGGCTACAATAAG - UNI15434 -

 - UNI30825 - TTGGCCAGCTTTAGTCTGTCTCCTTCTTCTCCATACCCTACCACTGTGGGCCCAGTGGAGAGCAGTGGATTGAGAGCTCGCTACCG

TTCTCCACCCACGGTCTACAACTCACCCACTGACAAAGAGGACTACATGACAGACCTGAGAACTTTGGACACGTTCCTTAGAAGTGAGGAAGAGAAACAG

CATAGAGTGAAGCTGG - UNI17340 - - UNI30825 - GGAGCCCAGATTCCACCTCTCCTTCTACCAGCCCTACCTTCTGGAATTACAGTCGTT

CTGTGGGTGATTATGCACAAACCTTAAAGAAGTTTCAGTATCAGCTTGCCTGTAGATCACAGGCCCCATGTGCTAACAAAGATGAAGCCGATCTCATTTC

TAAGCAAGCTGCAGAAGAG GTCTGGGCAAGAGTGACTATGAATAGACAGCTTCTCGATCACATGGATTCATGGACAGCCAAGTTTAGAAAT ATCATCA

TGCATGTGTTTTGCACCTACCTTGATTCCAGATTACCTCCACACCCTAAGTACCCTGATGGAAAAACATTCACTTCTCAGCACTTCGTTCAGACGCCAAA

TAAACCAG ATGTTACGAATGAAAATGTGTTTTGTATTTATCAGAGTGCTGTCAACCCTCCACATTATGAGCTAATCTATCAGCGGCATGTCTACAATCT

TCCAAAG GGCAGGAATAATATGTTTCATACGTTGCTGATGTTCCTTTATATCATAAAGACCAAAGAGTCAGGAATGCTTGG GAGAGTTAACCTTGGGC

TCTCTGGCGTGAACATTTTGTGGATCTTTGGAGAGTAGTTCCTCATTTAATTCCAAACATTTGGACTTTGCTTTTAACTGGTCTGGAAGAAGTTGGAGCT

GAGCCCCTCCGAGTGCGCACCTCTTCTGACATAAGATGCATGTTTTGCAGACTTGTTAAATTTAACAGGAGACAAGCTGTGGGAGCTTCTTGTGAGCATA

GCAAAGCCTGCACCTTCTAGTCCACAGAAAAGCATTACACTGGATGGCTCTGAGCGAGCTAGTGCCGCTCCCTTCATTTGGTGAGGGCAAGGACGCCTCT

CCATTTTAACCCCAGTGAGAACCTGCACCTCATCCTGTACCATCAGAGACTGCTTTCATTGTTGGATAGTAGTGTAAGTTCTCAGATGAACCTTGCTAGT

TCTCTTTGTTGTATCTTTATATTTCCCCAGTGTTCTACAAGTCAGCCTAAAGCTGAAATGAAATTAATTTCTAAGTGATGTAGTAATTAATCCTGCTGAG

CCATCTCCCCAACCCCCTATTGTTTTTTTTAATATTAAAAGAGATTTGAT
Translation
M - UNI17151 - MQGDVSPNPSLIDRTIKMRKETETRKVVLAWGLLNVSMAGMIYTEM - UNI17151 - - UNI18891 - MTGKLISTYYNV

TYWPLWYIE - UNI15434 - ELALASLFSLNALFDFWRYFKYTVAPTSLVVSPGQQALLGLKQAV - UNI15434 - - UNI30825 - VVQTT

PPRDLAATQISPSPPSPSIQGQSVLSYSPSRSPSTSPKFATSCMTGYSPQLQGLSSGGLGSYSPGVTYSPVSGYNK - UNI15434 - - UNI30825

 - LASFSLSPSSPYPTTVGPVESSGLRARYRSPPTVYNSPTDKEDYMTDLRTLDTFLRSEEEKQHRVKLG - UNI17340 - - UNI30825 - GS

PDSTSPSTSPTFWNYSRSVGDYAQTLKKFQYQLACRSQAPCANKDEADLISKQAAEE VWARVTMNRQLLDHMDSWTAKFRN IIMHVFCTYLDSRLPPH

PKYPDGKTFTSQHFVQTPNKPD DVTNENVFCIYQSAVNPPHYELIYQRHVYNLPK GRNNMFHTLLMFLYIIKTKESGMLG GRVNLGLSGVNILWIFG

E
Transcript ENSMUST00000115160
Sequence
TGGCGCGAGTCCACGGCTTCCTGCTGAAGAACATG - UNI17151 - ATGCAAGGAGACGTAAGCCCCAATCCTTCCCTTATTGACAGAACCATCAAG

ATGAGAAAAGAAACAGAAACTAGGAAAGTGGTTTTAGCTTGGGGACTCCTAAATGTATCCATGGCTGGAATGATATATACTGAAAT - UNI17151 - 

- UNI18891 - GACTGGAAAGTTAATCAGTACATATTATAATGTGACATACTGGCCCCTCTGGTATATCG - UNI15434 - AACTCGCACTTGCA

TCGCTCTTCAGTCTTAATGCCTTGTTTGATTTTTGGAGATACTTCAAATATACCGTAGCACCAACAAGTCTGGTAGTTAGCCCCGGACAGCAAGCACTGT

TAGGGTTGAAACAGGCTG - UNI15434 - - UNI30825 - TTGTGCAGACTACACCTCCCCGTGATTTGGCAGCAACCCAAATCTCTCCATCTCC

ACCTTCCCCTTCGATTCAAGGTCAAAGTGTGTTAAGTTATAGCCCATCTCGTTCACCCAGTACCAGTCCCAAGTTTGCCACCAGCTGTATGACTGGGTAT

AGCCCTCAACTGCAAGGCCTGTCGTCAGGAGGCCTTGGCTCTTACAGCCCTGGTGTGACTTACTCGCCTGTCAGTGGCTACAATAAG - UNI15434 -

 - UNI30825 - TTGGCCAGCTTTAGTCTGTCTCCTTCTTCTCCATACCCTACCACTGTGGGCCCAGTGGAGAGCAGTGGATTGAGAGCTCGCTACCG

TTCTCCACCCACGGTCTACAACTCACCCACTGACAAAGAGGACTACATGACAGACCTGAGAACTTTGGACACGTTCCTTAGAAGTGAGGAAGAGAAACAG

CATAGAGTGAAGCTGG - UNI17340 - - UNI30825 - GGAGCCCAGATTCCACCTCTCCTTCTACCAGCCCTACCTTCTGGAATTACAGTCGTT

CTGTGGGTGATTATGCACAAACCTTAAAGAAGTTTCAGTATCAGCTTGCCTGTAGATCACAGGCCCCATGTGCTAACAAAGATGAAGCCGATCTCATTTC

TAAGCAAGCTGCAGAAGAG GTCTGGGCAAGAGTGACTATGAATAGACAGCTTCTCGATCACATGGATTCATGGACAGCCAAGTTTAGAAAT TGGATCA

GTGAGACAATATTGGTGCCGCTTGTGCAAGAGATTGAGTCTGTCAGCACCCAGATGAGAAGGATGGGCTGTCCAGAGCTACAAATAGGAG AGGCGAGTG

TTACCAGCTTGAAGCAAGCTGCCCTGGTCAGAGCTCCTCTCATTCCAACTCTGAATGCAATTGTGCAGTATTTAGACCTCACACCAAATCAGGAGTACTT

GTTTGAAAGAATCAAAG AACTTTCTCAGGGGGGCTGTATGAGTTCATTCAGATGGAACAGAGGTGGAGACTTCAAAGGACGCAAATGGGATACAGACCT

GCCCACTGATTCTGCT ATCATCATGCATGTGTTTTGCACCTACCTTGATTCCAGATTACCTCCACACCCTAAGTACCCTGATGGAAAAACATTCACTTC

TCAGCACTTCGTTCAGACGCCAAATAAACCAG ATGTTACGAATGAAAATGTGTTTTGTATTTATCAGAGTGCTGTCAACCCTCCACATTATGAGCTAAT

CTATCAGCGGCATGTCTACAATCTTCCAAAG GGCAGGAATAATATGTTTCATACGTTGCTGATGTTCCTTTATATCATAAAGACCAAAGAGTCAGGAAT

GCTTGG GAGAGTTAACCTTGGGCTCTCTGGCGTGAACATTTTGTGGATCTTTGGAGAGTAGTTCCTCATTTAATTCCAAACATTTGGACTTTGCTTTTA

ACTGGTCTGGAAGAAGTTGGAGCTGAGCCCCTCCGAGTGCGCACCTCTTCTGACATAAGATGCATGTTTTGCAGACTTGTTAAATTTAACAGGAGACAAG

CTGTGGGAGCTTCTTGTGAGCATAGCAAAGCCTGCACCTTCTAGTCCACAGAAAAGCATTACACTGGATGGCTCTGAGCGAGCTAGTGCCGCTCCCTTCA

TTTGGTGAGGGCAAGGACGCCTCTCCATTTTAACCCCAGTGAGAACCTGCACCTCATCCTGTACCATCAGAGACTGCTTTCATTGTTGGATAGTAGTGTA

AGTTCTCAGATGAACCTTGCTAGTTCTCTTTGTTGTATCTTTATATTTCCCCAGTGTTCTACAAGTCAGCCTAAAGCTGAAATGAAATTAATTTCTAAGT

GATGTAGTAATTAATCCTGCTGAGCCATCTCCCCAACCCCCTATTGTTTTTTTTAATATTAAAAGAGATTTGAT
Translation
M - UNI17151 - MQGDVSPNPSLIDRTIKMRKETETRKVVLAWGLLNVSMAGMIYTEM - UNI17151 - - UNI18891 - MTGKLISTYYNV

TYWPLWYIE - UNI15434 - ELALASLFSLNALFDFWRYFKYTVAPTSLVVSPGQQALLGLKQAV - UNI15434 - - UNI30825 - VVQTT

PPRDLAATQISPSPPSPSIQGQSVLSYSPSRSPSTSPKFATSCMTGYSPQLQGLSSGGLGSYSPGVTYSPVSGYNK - UNI15434 - - UNI30825

 - LASFSLSPSSPYPTTVGPVESSGLRARYRSPPTVYNSPTDKEDYMTDLRTLDTFLRSEEEKQHRVKLG - UNI17340 - - UNI30825 - GS

PDSTSPSTSPTFWNYSRSVGDYAQTLKKFQYQLACRSQAPCANKDEADLISKQAAEE VWARVTMNRQLLDHMDSWTAKFRN WISETILVPLVQEIESV

STQMRRMGCPELQIGE EASVTSLKQAALVRAPLIPTLNAIVQYLDLTPNQEYLFERIKE ELSQGGCMSSFRWNRGGDFKGRKWDTDLPTDSA IIMHV

FCTYLDSRLPPHPKYPDGKTFTSQHFVQTPNKPD DVTNENVFCIYQSAVNPPHYELIYQRHVYNLPK GRNNMFHTLLMFLYIIKTKESGMLG GRVNL

GLSGVNILWIFGE
Transcript ENSMUST00000058831
Sequence
TGGCGCGAGTCCACGGCTTCCTGCTGAAGAACATG - UNI17151 - ATGCAAGGAGACGTAAGCCCCAATCCTTCCCTTATTGACAGAACCATCAAG

ATGAGAAAAGAAACAGAAACTAGGAAAGTGGTTTTAGCTTGGGGACTCCTAAATGTATCCATGGCTGGAATGATATATACTGAAAT - UNI17151 - 

- UNI18891 - GACTGGAAAGTTAATCAGTACATATTATAATGTGACATACTGGCCCCTCTGGTATATCG - UNI15434 - AACTCGCACTTGCA

TCGCTCTTCAGTCTTAATGCCTTGTTTGATTTTTGGAGATACTTCAAATATACCGTAGCACCAACAAGTCTGGTAGTTAGCCCCGGACAGCAAGCACTGT

TAGGGTTGAAACAGGCTG - UNI15434 - - UNI30825 - TTGTGCAGACTACACCTCCCCGTGATTTGGCAGCAACCCAAATCTCTCCATCTCC

ACCTTCCCCTTCGATTCAAGGTCAAAGTGTGTTAAGTTATAGCCCATCTCGTTCACCCAGTACCAGTCCCAAGTTTGCCACCAGCTGTATGACTGGGTAT

AGCCCTCAACTGCAAGGCCTGTCGTCAGGAGGCCTTGGCTCTTACAGCCCTGGTGTGACTTACTCGCCTGTCAGTGGCTACAATAAG - UNI15434 -

 - UNI30825 - TTGGCCAGCTTTAGTCTGTCTCCTTCTTCTCCATACCCTACCACTGTGGGCCCAGTGGAGAGCAGTGGATTGAGAGCTCGCTACCG

TTCTCCACCCACGGTCTACAACTCACCCACTGACAAAGAGGACTACATGACAGACCTGAGAACTTTGGACACGTTCCTTAGAAGTGAGGAAGAGAAACAG

CATAGAGTGAAGCTGG - UNI17340 - - UNI30825 - GGAGCCCAGATTCCACCTCTCCTTCTACCAGCCCTACCTTCTGGAATTACAGTCGTT

CTGTGGGTGATTATGCACAAACCTTAAAGAAGTTTCAGTATCAGCTTGCCTGTAGATCACAGGCCCCATGTGCTAACAAAGATGAAGCCGATCTCATTTC

TAAGCAAGCTGCAGAAGAG GTCTGGGCAAGAGTGACTATGAATAGACAGCTTCTCGATCACATGGATTCATGGACAGCCAAGTTTAGAAAT TGGATCA

GTGAGACAATATTGGTGCCGCTTGTGCAAGAGATTGAGTCTGTCAGCACCCAGATGAGAAGGATGGGCTGTCCAGAGCTACAAATAGGAG AGGCGAGTG

TTACCAGCTTGAAGCAAGCTGCCCTGGTCAGAGCTCCTCTCATTCCAACTCTGAATGCAATTGTGCAGTATTTAGACCTCACACCAAATCAGGAGTACTT

GTTTGAAAGAATCAAAG AACTTTCTCAGGGGGGCTGTATGAGTTCATTCAGATGGAACAGAGGTGGAGACTTCAAAGGACGCAAATGGGATACAGACCT

GCCCACTGATTCTGCT ATCATCATGCATGTGTTTTGCACCTACCTTGATTCCAGATTACCTCCACACCCTAAGTACCCTGATGGAAAAACATTCACTTC

TCAGCACTTCGTTCAGACGCCAAATAAACCAG ATGTTACGAATGAAAATGTGTTTTGTATTTATCAGAGTGCTGTCAACCCTCCACATTATGAGCTAAT

CTATCAGCGGCATGTCTACAATCTTCCAAAG GGCAGGAATAATATGTTTCATACGTTGCTGATGTTCCTTTATATCATAAAGACCAAAGAGTCAGGAAT

GCTTGG GAGAGTTAACCTTGGGCTCTCTGGC GAACATTTTGTGGATCTTTGGAGAGTAGTTCCTCATTTAATTCCAAACATTTGGACTTTGCTTTTAA

CTGGTCTGGAAGAAGTTGGAGCTGAGCCCCTCCGAGTGCGCACCTCTTCTGACATAAGATGCATGTTTTGCAGACTTGTTAAATTTAACAGGAGACAAGC

TGTGGGAGCTTCTTGTGAGCATAGCAAAGCCTGCACCTTCTAG
Translation
 - UNI17151 - MQGDVSPNPSLIDRTIKMRKETETRKVVLAWGLLNVSMAGMIYTEM - UNI17151 - - UNI18891 - MTGKLISTYYNVT

YWPLWYIE - UNI15434 - ELALASLFSLNALFDFWRYFKYTVAPTSLVVSPGQQALLGLKQAV - UNI15434 - - UNI30825 - VVQTTP

PRDLAATQISPSPPSPSIQGQSVLSYSPSRSPSTSPKFATSCMTGYSPQLQGLSSGGLGSYSPGVTYSPVSGYNK - UNI15434 - - UNI30825 

- LASFSLSPSSPYPTTVGPVESSGLRARYRSPPTVYNSPTDKEDYMTDLRTLDTFLRSEEEKQHRVKLG - UNI17340 - - UNI30825 - GSP

DSTSPSTSPTFWNYSRSVGDYAQTLKKFQYQLACRSQAPCANKDEADLISKQAAEE VWARVTMNRQLLDHMDSWTAKFRN WISETILVPLVQEIESVS

TQMRRMGCPELQIGE EASVTSLKQAALVRAPLIPTLNAIVQYLDLTPNQEYLFERIKE ELSQGGCMSSFRWNRGGDFKGRKWDTDLPTDSA IIMHVF

CTYLDSRLPPHPKYPDGKTFTSQHFVQTPNKPD DVTNENVFCIYQSAVNPPHYELIYQRHVYNLPK GRNNMFHTLLMFLYIIKTKESGMLG GRVNLG

LSG EHFVDLWRVVPHLIPNIWTLLLTGLEEVGAEPLRVRTSSDIRCMFCRLVKFNRRQAVGASCEHSKACTF
Transcript ENSMUST00000064330
Sequence
GCGAGTCCACGGCTTCCTGCTGAAGAACATG - UNI17151 - ATGCAAGGAGACGTAAGCCCCAATCCTTCCCTTATTGACAGAACCATCAAGATGA

GAAAAGAAACAGAAACTAGGAAAGTGGTTTTAGCTTGGGGACTCCTAAATGTATCCATGGCTGGAATGATATATACTGAAAT - UNI17151 - - UN

I18891 - GACTGGAAAGTTAATCAGTACATATTATAATGTGACATACTGGCCCCTCTGGTATATCG - UNI15434 - AACTCGCACTTGCATCGC

TCTTCAGTCTTAATGCCTTGTTTGATTTTTGGAGATACTTCAAATATACCGTAGCACCAACAAGTCTGGTAGTTAGCCCCGGACAGCAAGCACTGTTAGG

GTTGAAACAGGCTG - UNI15434 - - UNI30825 - TTGTGCAGACTACACCTCCCCGTGATTTGGCAGCAACCCAAATCTCTCCATCTCCACCT

TCCCCTTCGATTCAAGGTCAAAGTGTGTTAAGTTATAGCCCATCTCGTTCACCCAGTACCAGTCCCAAGTTTGCCACCAGCTGTATGACTGGGTATAGCC

CTCAACTGCAAGGCCTGTCGTCAGGAGGCCTTGGCTCTTACAGCCCTGGTGTGACTTACTCGCCTGTCAGTGGCTACAATAAG - UNI15434 - - U

NI30825 - TTGGCCAGCTTTAGTCTGTCTCCTTCTTCTCCATACCCTACCACTGTGGGCCCAGTGGAGAGCAGTGGATTGAGAGCTCGCTACCGTTCT

CCACCCACGGTCTACAACTCACCCACTGACAAAGAGGACTACATGACAGACCTGAGAACTTTGGACACGTTCCTTAGAAGTGAGGAAGAGAAACAGCATA

GAGTGAAGCTGG - UNI17340 - - UNI30825 - GGAGCCCAGATTCCACCTCTCCTTCTACCAGCCCTACCTTCTGGAATTACAGTCGTTCTGT

GGGTGATTATGCACAAACCTTAAAGAAGTTTCAGTATCAGCTTGCCTGTAGATCACAGGCCCCATGTGCTAACAAAGATGAAGCCGATCTCATTTCTAAG

CAAGCTGCAGAAGAG GTCTGGGCAAGAGTGACTATGAATAGACAGCTTCTCGATCACATGGATTCATGGACAGCCAAGTTTAGAAAT ATCATCATGCA

TGTGTTTTGCACCTACCTTGATTCCAGATTACCTCCACACCCTAAGTACCCTGATGGAAAAACATTCACTTCTCAGCACTTCGTTCAGACGCCAAATAAA

CCAG ATGTTACGAATGAAAATGTGTTTTGTATTTATCAGAGTGCTGTCAACCCTCCACATTATGAGCTAATCTATCAGCGGCATGTCTACAATCTTCCA

AAG GGCAGGAATAATATGTTTCATACGTTGCTGATGTTCCTTTATATCATAAAGACCAAAGAGTCAGGAATGCTTGG GAATTGAATCCAGGGTACAGC

TTACCGAGTACCACTGAGCTGCCTCCCCAGCCTCCAATATAGCAGTTTCTTGTATTAAAGTGAGTCAATATCTACTAACACCACAAATCCTCCTAGGATG

TGTGTCACGTGTTCCTTTTCTTTGCTTGGCTCAGATCCATGAATCTAGATTACGTTCACTGTGACATTTATCTTTTTCTTTATCAATACCAGCCTTTACT

TAAACCAAATTTGTTTTAAAGCATACTGAAAGTGTTTATAATCTAGTTTCCACTGAGACAGAAATGCTATGTTACTTGGTTTTCTCAAACTAATATATTC

TTCAAGCTGATATTTGAATG
Translation
M - UNI17151 - MQGDVSPNPSLIDRTIKMRKETETRKVVLAWGLLNVSMAGMIYTEM - UNI17151 - - UNI18891 - MTGKLISTYYNV

TYWPLWYIE - UNI15434 - ELALASLFSLNALFDFWRYFKYTVAPTSLVVSPGQQALLGLKQAV - UNI15434 - - UNI30825 - VVQTT

PPRDLAATQISPSPPSPSIQGQSVLSYSPSRSPSTSPKFATSCMTGYSPQLQGLSSGGLGSYSPGVTYSPVSGYNK - UNI15434 - - UNI30825

 - LASFSLSPSSPYPTTVGPVESSGLRARYRSPPTVYNSPTDKEDYMTDLRTLDTFLRSEEEKQHRVKLG - UNI17340 - - UNI30825 - GS

PDSTSPSTSPTFWNYSRSVGDYAQTLKKFQYQLACRSQAPCANKDEADLISKQAAEE VWARVTMNRQLLDHMDSWTAKFRN IIMHVFCTYLDSRLPPH

PKYPDGKTFTSQHFVQTPNKPD DVTNENVFCIYQSAVNPPHYELIYQRHVYNLPK GRNNMFHTLLMFLYIIKTKESGMLG GN

For any suggestions or comments, please send an email to unitrap@crg.es