Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029822 (Osbpl3)
Chromosomal location
Chr 6: 50246800 - 50406081 (-)
Description
oxysterol binding protein-like 3 Gene [Source:MGI (curated);Acc:Osbpl3-001]
RefSeq_dna
NM_027881 
RefSeq_peptide
NP_082157.1 
UniGene
Mm.412261 
MGI
MGI:1918970 
Uniprot/SWISSPROT
Q9DBS9 
Uniprot/SPTREMBL
Q80UX3 Q6A012 
Human Ortholog
ENSG00000070882 (OSBPL3)
Omim not available
UniTrap UNI32829
Vector Insertion
Chr 6: 50332788 - 50378420
Public Clones (egtc) IST14601G8 (tigm) IST14606G12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28188
Vector Insertion
Chr 6: 50320358 - 50332788
Public Clones D060G06 (ggtc) IST14743H2 (tigm)
Private Clones OST37774 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28013
Vector Insertion
Chr 6: 50270174 - 50272971
Public Clones not available
Private Clones OST42233 (lexicon) OST42190 (lexicon)
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32341
Vector Insertion
Chr 6: 50262630 - 50270174
Public Clones IST12341D7 (tigm) IST13055A3 (tigm) IST11921F5 (tigm) IST10120G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114466
Sequence
ATGAGTGACGAGAAGAATCTCGGTGTGTCTCAAAAGTTGGTTTCACCTTCAAGAAGCACAAGTAGTTGCTCCTCCAAGCAAGGAAGCCGGCAG GACAGC

TGGGAAGTCGTGGAAGGATTGAGAGGGGAAATGACTTACACCCAGGAGCCGCCAGTGCAGAAAGGATTTTTGCTGAAAAAGAGGAAGTGGCCCTTAAAAG

GCTGGCACAAG AGATTCTTCTGCCTGGAAAAGGGAATCTTGAAATATGCCAAGAGCCAAGCTGAT ATTGAGCGGGAGAAGTTGCATGGCTGCATTGAC

GTGGGGCTCTCTGTGATGTCTGTGAAGAAGTCGTCTAAGTGTATCGACCTAGACACGGAGGAGCACATCTACCACCTGAAG GTGAAGTCAGAAGAACTC

TTTGACGAGTGGGTGTCCAAGCTCCGTCACCACAGAATGTACCGGCAGAATGAGATCGCCATGTTTCCCCGGGATGTCAATCACTTTTTCTCAGGGTCCT

CTGTCACAGATTCTGCCCCAGGAGTGTTCGAGTCAGTTTCCAGTAGGAAG CGTAGCAGTCTATCAAAGCAGAATTCATTTCCACCCGGAAGCAATTTGT

CATTTTCTTGTGGTGGCGACACTCGAGTTCCTTTCTGGCTACAGTCTTCAGAGGACATGGAAAAATGTTCAAAAG ACATGGCACACTGCCATGCCTACC

TGCTGGAAATGAGCCAGCTCTTAGAAAGCATGGACGTCCTGCATCGGACATACTCGGCGCCAGCCATCAACGCCATCCAG GGTGGAGCTTTTGAAAGTC

CCAAAAAGGAAAAACGACCACACAGGAGGTGGCGGTCCAGAGCTATTGGCAAAGATGCTAAAGGAACGCTGCAG GTCCCTAAGCCTTTTTCTGGCCCTG

TGAGACTGCACTCCTCCAATCCTAACTTGTCGACGCTGGACTTTGGAGAAGAGAAGTCTTACTCGGATGGTTCTGAAGCCTCGTCGGAGTTCTCCAAGAT

GCAGGAGGATCTGTGCCATGTCGCCCACAAAG TTTACTTCGCTTTAAGGTCGGCTTTCAATAGCATATCGGTGGAGAGAGAGAAACTGAAGCAGCTGAT

GGAGCTGGACACCTCCCCCTCCCCCTCCGCTCAGGTCGTCGGGCTGAAGCACGCTCTGTCATCC GAAAACTCCAGGGATGAGGGCCGAGCCCTGGTGCA

CCAGCTCTCCAATGAGAGCAGGCTGTCTATCACCGACTCCCTTTCTGAGTTCTTCGATGCCCAGGAAGTTCTGCTGTCTCCTAGCTCTTCAGAAAACGAG

 ATTTCTGATGATGATTCATACGTCAGTGACATAAGTGATAATCTGTCCTTAGACAACCTCAGTAATGATTTAGACAATGAAAGACAGACCTTGG GGCC

TGTTCTCGAGAGTAGTGGGGAAGCCAGATCCAAAAGGAGGACCAGCTTGCCGGCACCGGGTCCCAACACCAGTAGCGTTAGCTTGTGGAGCATCCTGCGC

AACAACATTGGGAAGGACCTGTCCAAGGTGGCCATGCCGGTGGAGCTGAACGAGCCCCTGAACACGCTGCAGCGGCTCTGCGAGGAGCTGGAATACAGCG

AGCTTCTGGACAAGGCCTCGAGAATCCCCAGTCCCCTGGAGAGGATG - UNI28013 - - UNI32341 - GTGTACGTAGCAGCCTTCGCCATCTC

CGCATATGCATCCAGCTACTTCCGAGCAGGCAGCAAGCCGTTTAACCCGGTCCTTGGAGAAACGTACGAATGCATCCGACAGGACAAGGGTTTCCAGTTT

TTTGCCGAGCAG - UNI32341 - GTCAGCCACCACCCACCTATCTCCGCCTGCCACGCTGAGTCCGGAAACTTTGTTTTCTGGCAAG - UNI3234

1 - ATGTGAGATGGAAAAATAAATTCTGGGGTAAATCCATGGAAATTGTCCCGATTGGCACAACCCACGTGACTCTGCCTGC TTTTGGAGATCACTTT

GAGTGGAACAAAGTAACCTCCTGCATCCACAACATCTTGAGCGGACAGCGATGGATCGAGCACTATGGCGAAATTGACATCAAGAACCTGAATGACGACT

CCTGCCACTGCAAAGTGAACTTCATAAAG GCTAAGTACTGGAGCACTAATGCCCACGAGATCGAAGGCACGGTGTTCGACCGCAGTGGGAAGGCTGTGC

ACCGGCTGTTTGGGAAATGGCACGAGAGCATCTACTGTGGCGGCGCCTCCTCTTCCACATGCGTCTGGAGAGCAA ATCCCATGCCGAAAGGCTATGAGC

AGTATTATGGCTTCACACAGTTTGCACTAGAGTTAAATGAAATGGATCCTTTGTCAAGGTCTTTATTACCACCCACCGACACTCGGTTTAGACCAGATCA

AAG GCTTCTAGAGGAAGGGAACATAGAGGAGGCTGAGGTTCAGAAGCAGAGGATCGAGAAGCTGCAGAGAGAGCGGCGGAGGGTCTTGGAGGAGAACGG

TGTGGAGCACCAGCCCCGGTTTTTCAG GAAATCCAGTGACGATGCTTGGGTAAGCAATGGGACCTACCTGGAACTGAGGAAAGACCTTGGCTTTTCCAA

GTTGGACCATCCCGTCTTATGGTGA
Translation
MSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQ DSWEVVEGLRGEMTYTQEPPVQKGFLLKKRKWPLKGWHK RFFCLEKGILKYAKSQAD IEREKLHGC

IDVGLSVMSVKKSSKCIDLDTEEHIYHLK VKSEELFDEWVSKLRHHRMYRQNEIAMFPRDVNHFFSGSSVTDSAPGVFESVSSRK RSSLSKQNSFPPG

SNLSFSCGGDTRVPFWLQSSEDMEKCSKD DMAHCHAYLLEMSQLLESMDVLHRTYSAPAINAIQ GGAFESPKKEKRPHRRWRSRAIGKDAKGTLQ VP

KPFSGPVRLHSSNPNLSTLDFGEEKSYSDGSEASSEFSKMQEDLCHVAHKV VYFALRSAFNSISVEREKLKQLMELDTSPSPSAQVVGLKHALSS ENS

RDEGRALVHQLSNESRLSITDSLSEFFDAQEVLLSPSSSENE ISDDDSYVSDISDNLSLDNLSNDLDNERQTLG GPVLESSGEARSKRRTSLPAPGPN

TSSVSLWSILRNNIGKDLSKVAMPVELNEPLNTLQRLCEELEYSELLDKASRIPSPLERM - UNI28013 - - UNI32341 - VYVAAFAISAYAS

SYFRAGSKPFNPVLGETYECIRQDKGFQFFAEQ - UNI32341 - VSHHPPISACHAESGNFVFWQD - UNI32341 - DVRWKNKFWGKSMEIVP

IGTTHVTLPA AFGDHFEWNKVTSCIHNILSGQRWIEHYGEIDIKNLNDDSCHCKVNFIK AKYWSTNAHEIEGTVFDRSGKAVHRLFGKWHESIYCGGA

SSSTCVWRAN NPMPKGYEQYYGFTQFALELNEMDPLSRSLLPPTDTRFRPDQR RLLEEGNIEEAEVQKQRIEKLQRERRRVLEENGVEHQPRFFR RK

SSDDAWVSNGTYLELRKDLGFSKLDHPVLW
Transcript ENSMUST00000090019
Sequence
ATGAGTGACGAGAAGAATCTCGGTGTGTCTCAAAAGTTGGTTTCACCTTCAAGAAGCACAAGTAGTTGCTCCTCCAAGCAAGGAAGCCGGCAG GACAGC

TGGGAAGTCGTGGAAGGATTGAGAGGGGAAATGACTTACACCCAGGAGCCGCCAGTGCAGAAAGGATTTTTGCTGAAAAAGAGGAAGTGGCCCTTAAAAG

GCTGGCACAAG AGATTCTTCTGCCTGGAAAAGGGAATCTTGAAATATGCCAAGAGCCAAGCTGAT ATTGAGCGGGAGAAGTTGCATGGCTGCATTGAC

GTGGGGCTCTCTGTGATGTCTGTGAAGAAGTCGTCTAAGTGTATCGACCTAGACACGGAGGAGCACATCTACCACCTGAAG GTGAAGTCAGAAGAACTC

TTTGACGAGTGGGTGTCCAAGCTCCGTCACCACAGAATGTACCGGCAGAATGAGATCGCCATGTTTCCCCGGGATGTCAATCACTTTTTCTCAGGGTCCT

CTGTCACAGATTCTGCCCCAGGAGTGTTCGAGTCAGTTTCCAGTAGGAAG CGTAGCAGTCTATCAAAGCAGAATTCATTTCCACCCGGAAGCAATTTGT

CATTTTCTTGTGGTGGCGACACTCGAGTTCCTTTCTGGCTACAGTCTTCAGAGGACATGGAAAAATGTTCAAAAG ACATGGCACACTGCCATGCCTACC

TGCTGGAAATGAGCCAGCTCTTAGAAAGCATGGACGTCCTGCATCGGACATACTCGGCGCCAGCCATCAACGCCATCCAG GGTGGAGCTTTTGAAAGTC

CCAAAAAGGAAAAACGACCACACAGGAGGTGGCGGTCCAGAGCTATTGGCAAAGATGCTAAAGGAACGCTGCAG GTCCCTAAGCCTTTTTCTGGCCCTG

TGAGACTGCACTCCTCCAATCCTAACTTGTCGACGCTGGACTTTGGAGAAGAGAAGTCTTACTCGGATGGTTCTGAAGCCTCGTCGGAGTTCTCCAAGAT

GCAGGAGGATCTGTGCCATGTCGCCCACAAAG TTTACTTCGCTTTAAGGTCGGCTTTCAATAGCATATCGGTGGAGAGAGAGAAACTGAAGCAGCTGAT

GGAGCTGGACACCTCCCCCTCCCCCTCCGCTCAGGTCGTCGGGCTGAAGCACGCTCTGTCATCC GCCCTAGCACAAAACACAGATCTTAAAGAACGCTT

ACGCAGAATCCATGCGGAATCTCTGCTCCTCGACCCGCCCGCTGTTCCCAAGCCGGGGGACAACCTGGCAGAG GAAAACTCCAGGGATGAGGGCCGAGC

CCTGGTGCACCAGCTCTCCAATGAGAGCAGGCTGTCTATCACCGACTCCCTTTCTGAGTTCTTCGATGCCCAGGAAGTTCTGCTGTCTCCTAGCTCTTCA

GAAAACGAG ATTTCTGATGATGATTCATACGTCAGTGACATAAGTGATAATCTGTCCTTAGACAACCTCAGTAATGATTTAGACAATGAAAGACAGACC

TTGG GGCCTGTTCTCGAGAGTAGTGGGGAAGCCAGATCCAAAAGGAGGACCAGCTTGCCGGCACCGGGTCCCAACACCAGTAGCGTTAGCTTGTGGAGC

ATCCTGCGCAACAACATTGGGAAGGACCTGTCCAAGGTGGCCATGCCGGTGGAGCTGAACGAGCCCCTGAACACGCTGCAGCGGCTCTGCGAGGAGCTGG

AATACAGCGAGCTTCTGGACAAGGCCTCGAGAATCCCCAGTCCCCTGGAGAGGATG - UNI28013 - - UNI32341 - GTGTACGTAGCAGCCTT

CGCCATCTCCGCATATGCATCCAGCTACTTCCGAGCAGGCAGCAAGCCGTTTAACCCGGTCCTTGGAGAAACGTACGAATGCATCCGACAGGACAAGGGT

TTCCAGTTTTTTGCCGAGCAG - UNI32341 - GTCAGCCACCACCCACCTATCTCCGCCTGCCACGCTGAGTCCGGAAACTTTGTTTTCTGGCAAG 

- UNI32341 - ATGTGAGATGGAAAAATAAATTCTGGGGTAAATCCATGGAAATTGTCCCGATTGGCACAACCCACGTGACTCTGCCTGC TTTTGGA

GATCACTTTGAGTGGAACAAAGTAACCTCCTGCATCCACAACATCTTGAGCGGACAGCGATGGATCGAGCACTATGGCGAAATTGACATCAAGAACCTGA

ATGACGACTCCTGCCACTGCAAAGTGAACTTCATAAAG GCTAAGTACTGGAGCACTAATGCCCACGAGATCGAAGGCACGGTGTTCGACCGCAGTGGGA

AGGCTGTGCACCGGCTGTTTGGGAAATGGCACGAGAGCATCTACTGTGGCGGCGCCTCCTCTTCCACATGCGTCTGGAGAGCAA ATCCCATGCCGAAAG

GCTATGAGCAGTATTATGGCTTCACACAGTTTGCACTAGAGTTAAATGAAATGGATCCTTTGTCAAGGTCTTTATTACCACCCACCGACACTCGGTTTAG

ACCAGATCAAAG GCTTCTAGAGGAAGGGAACATAGAGGAGGCTGAGGTTCAGAAGCAGAGGATCGAGAAGCTGCAGAGAGAGCGGCGGAGGGTCTTGGA

GGAGAACGGTGTGGAGCACCAGCCCCGGTTTTTCAG GAAATCCAGTGACGATGCTTGGGTAAGCAATGGGACCTACCTGGAACTGAGGAAAGACCTTGG

CTTTTCCAAGTTGGACCATCCCGTCTTATGGTGA
Translation
MSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQ DSWEVVEGLRGEMTYTQEPPVQKGFLLKKRKWPLKGWHK RFFCLEKGILKYAKSQAD IEREKLHGC

IDVGLSVMSVKKSSKCIDLDTEEHIYHLK VKSEELFDEWVSKLRHHRMYRQNEIAMFPRDVNHFFSGSSVTDSAPGVFESVSSRK RSSLSKQNSFPPG

SNLSFSCGGDTRVPFWLQSSEDMEKCSKD DMAHCHAYLLEMSQLLESMDVLHRTYSAPAINAIQ GGAFESPKKEKRPHRRWRSRAIGKDAKGTLQ VP

KPFSGPVRLHSSNPNLSTLDFGEEKSYSDGSEASSEFSKMQEDLCHVAHKV VYFALRSAFNSISVEREKLKQLMELDTSPSPSAQVVGLKHALSS ALA

QNTDLKERLRRIHAESLLLDPPAVPKPGDNLAE ENSRDEGRALVHQLSNESRLSITDSLSEFFDAQEVLLSPSSSENE ISDDDSYVSDISDNLSLDNL

SNDLDNERQTLG GPVLESSGEARSKRRTSLPAPGPNTSSVSLWSILRNNIGKDLSKVAMPVELNEPLNTLQRLCEELEYSELLDKASRIPSPLERM - 

UNI28013 - - UNI32341 - VYVAAFAISAYASSYFRAGSKPFNPVLGETYECIRQDKGFQFFAEQ - UNI32341 - VSHHPPISACHAESGN

FVFWQD - UNI32341 - DVRWKNKFWGKSMEIVPIGTTHVTLPA AFGDHFEWNKVTSCIHNILSGQRWIEHYGEIDIKNLNDDSCHCKVNFIK AK

YWSTNAHEIEGTVFDRSGKAVHRLFGKWHESIYCGGASSSTCVWRAN NPMPKGYEQYYGFTQFALELNEMDPLSRSLLPPTDTRFRPDQR RLLEEGNI

EEAEVQKQRIEKLQRERRRVLEENGVEHQPRFFR RKSSDDAWVSNGTYLELRKDLGFSKLDHPVLW
Transcript ENSMUST00000114468
Sequence
GAGTCTGCGTCCTGCAGAAGTCCTGCATACTTTACCGCAGTGGACAGA - UNI28188 - - UNI32829 - AGATTTCCTCTGAGACTTCCAGAAT

GGCTTCTAAACACATTGGGTAAGAGCTGGCACCTGCCTGCGAGGACTTCATACTCTCAGCTCCACCATCTTCCCATGGCATTTTGACTGCGCTGAGCCCA

AAGGACCAGCTCTTCACAATGAGTGACGAGAAGAATCTCGGTGTGTCTCAAAAGTTGGTTTCACCTTCAAGAAGCACAAGTAGTTGCTCCTCCAAGCAAG

GAAGCCGGCAG GACAGCTGGGAAGTCGTGGAAGGATTGAGAGGGGAAATGACTTACACCCAGGAGCCGCCAGTGCAGAAAGGATTTTTGCTGAAAAAGA

GGAAGTGGCCCTTAAAAGGCTGGCACAAG AGATTCTTCTGCCTGGAAAAGGGAATCTTGAAATATGCCAAGAGCCAAGCTGAT ATTGAGCGGGAGAAG

TTGCATGGCTGCATTGACGTGGGGCTCTCTGTGATGTCTGTGAAGAAGTCGTCTAAGTGTATCGACCTAGACACGGAGGAGCACATCTACCACCTGAAG 

GTGAAGTCAGAAGAACTCTTTGACGAGTGGGTGTCCAAGCTCCGTCACCACAGAATGTACCGGCAGAATGAGATCGCCATGTTTCCCCGGGATGTCAATC

ACTTTTTCTCAGGGTCCTCTGTCACAGATTCTGCCCCAGGAGTGTTCGAGTCAGTTTCCAGTAGGAAG CGTAGCAGTCTATCAAAGCAGAATTCATTTC

CACCCGGAAGCAATTTGTCATTTTCTTGTGGTGGCGACACTCGAGTTCCTTTCTGGCTACAGTCTTCAGAGGACATGGAAAAATGTTCAAAAG ACATGG

CACACTGCCATGCCTACCTGCTGGAAATGAGCCAGCTCTTAGAAAGCATGGACGTCCTGCATCGGACATACTCGGCGCCAGCCATCAACGCCATCCAG G

TCCCTAAGCCTTTTTCTGGCCCTGTGAGACTGCACTCCTCCAATCCTAACTTGTCGACGCTGGACTTTGGAGAAGAGAAGTCTTACTCGGATGGTTCTGA

AGCCTCGTCGGAGTTCTCCAAGATGCAGGAGGATCTGTGCCATGTCGCCCACAAAG TTTACTTCGCTTTAAGGTCGGCTTTCAATAGCATATCGGTGGA

GAGAGAGAAACTGAAGCAGCTGATGGAGCTGGACACCTCCCCCTCCCCCTCCGCTCAGGTCGTCGGGCTGAAGCACGCTCTGTCATCC GCCCTAGCACA

AAACACAGATCTTAAAGAACGCTTACGCAGAATCCATGCGGAATCTCTGCTCCTCGACCCGCCCGCTGTTCCCAAGCCGGGGGACAACCTGGCAGAG GA

AAACTCCAGGGATGAGGGCCGAGCCCTGGTGCACCAGCTCTCCAATGAGAGCAGGCTGTCTATCACCGACTCCCTTTCTGAGTTCTTCGATGCCCAGGAA

GTTCTGCTGTCTCCTAGCTCTTCAGAAAACGAG ATTTCTGATGATGATTCATACGTCAGTGACATAAGTGATAATCTGTCCTTAGACAACCTCAGTAAT

GATTTAGACAATGAAAGACAGACCTTGG GGCCTGTTCTCGAGAGTAGTGGGGAAGCCAGATCCAAAAGGAGGACCAGCTTGCCGGCACCGGGTCCCAAC

ACCAGTAGCGTTAGCTTGTGGAGCATCCTGCGCAACAACATTGGGAAGGACCTGTCCAAGGTGGCCATGCCGGTGGAGCTGAACGAGCCCCTGAACACGC

TGCAGCGGCTCTGCGAGGAGCTGGAATACAGCGAGCTTCTGGACAAGGCCTCGAGAATCCCCAGTCCCCTGGAGAGGATG - UNI28013 - - UNI3

2341 - GTGTACGTAGCAGCCTTCGCCATCTCCGCATATGCATCCAGCTACTTCCGAGCAGGCAGCAAGCCGTTTAACCCGGTCCTTGGAGAAACGTAC

GAATGCATCCGACAGGACAAGGGTTTCCAGTTTTTTGCCGAGCAG - UNI32341 - GTCAGCCACCACCCACCTATCTCCGCCTGCCACGCTGAGTC

CGGAAACTTTGTTTTCTGGCAAG - UNI32341 - ATGTGAGATGGAAAAATAAATTCTGGGGTAAATCCATGGAAATTGTCCCGATTGGCACAACCC

ACGTGACTCTGCCTGC TTTTGGAGATCACTTTGAGTGGAACAAAGTAACCTCCTGCATCCACAACATCTTGAGCGGACAGCGATGGATCGAGCACTATG

GCGAAATTGACATCAAGAACCTGAATGACGACTCCTGCCACTGCAAAGTGAACTTCATAAAG GCTAAGTACTGGAGCACTAATGCCCACGAGATCGAAG

GCACGGTGTTCGACCGCAGTGGGAAGGCTGTGCACCGGCTGTTTGGGAAATGGCACGAGAGCATCTACTGTGGCGGCGCCTCCTCTTCCACATGCGTCTG

GAGAGCAA ATCCCATGCCGAAAGGCTATGAGCAGTATTATGGCTTCACACAGTTTGCACTAGAGTTAAATGAAATGGATCCTTTGTCAAGGTCTTTATT

ACCACCCACCGACACTCGGTTTAGACCAGATCAAAG GCTTCTAGAGGAAGGGAACATAGAGGAGGCTGAGGTTCAGAAGCAGAGGATCGAGAAGCTGCA

GAGAGAGCGGCGGAGGGTCTTGGAGGAGAACGGTGTGGAGCACCAGCCCCGGTTTTTCAG GAAATCCAGTGACGATGCTTGGGTAAGCAATGGGACCTA

CCTGGAACTGAGGAAAGACCTTGGCTTTTCCAAGTTGGACCATCCCGTCTTATGGTGAAATGTAAAAGAGAAGGAGATTTCCTGTAACTTTGCCCACATT

TGCTTCCGGAAGCAGCGCACAGCTGTCTGTATGTTTAAAAGATAGCATCTAGAATGATCACTTGTGCTTAGCGTAGCATTGTAAGCGCTGAAGTATATAT

TTTCTTCAGTAAGTCTCTTTAAAATTTCAAGTGTTATCATGATTGTTTATATGAATGTAGAACACCTCGGTATTTCTTTTTATATATATAAACTATTTAA

TAAAAATGAAAGATTG
Translation
 - UNI28188 - - UNI32829 - MSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQ DSWEVVEGLRGEMTYTQEPPVQKGFLLKKRKWPLKGWHK R

FFCLEKGILKYAKSQAD IEREKLHGCIDVGLSVMSVKKSSKCIDLDTEEHIYHLK VKSEELFDEWVSKLRHHRMYRQNEIAMFPRDVNHFFSGSSVTD

SAPGVFESVSSRK RSSLSKQNSFPPGSNLSFSCGGDTRVPFWLQSSEDMEKCSKD DMAHCHAYLLEMSQLLESMDVLHRTYSAPAINAIQ VPKPFSG

PVRLHSSNPNLSTLDFGEEKSYSDGSEASSEFSKMQEDLCHVAHKV VYFALRSAFNSISVEREKLKQLMELDTSPSPSAQVVGLKHALSS ALAQNTDL

KERLRRIHAESLLLDPPAVPKPGDNLAE ENSRDEGRALVHQLSNESRLSITDSLSEFFDAQEVLLSPSSSENE ISDDDSYVSDISDNLSLDNLSNDLD

NERQTLG GPVLESSGEARSKRRTSLPAPGPNTSSVSLWSILRNNIGKDLSKVAMPVELNEPLNTLQRLCEELEYSELLDKASRIPSPLERM - UNI28

013 - - UNI32341 - VYVAAFAISAYASSYFRAGSKPFNPVLGETYECIRQDKGFQFFAEQ - UNI32341 - VSHHPPISACHAESGNFVFWQ

D - UNI32341 - DVRWKNKFWGKSMEIVPIGTTHVTLPA AFGDHFEWNKVTSCIHNILSGQRWIEHYGEIDIKNLNDDSCHCKVNFIK AKYWSTN

AHEIEGTVFDRSGKAVHRLFGKWHESIYCGGASSSTCVWRAN NPMPKGYEQYYGFTQFALELNEMDPLSRSLLPPTDTRFRPDQR RLLEEGNIEEAEV

QKQRIEKLQRERRRVLEENGVEHQPRFFR RKSSDDAWVSNGTYLELRKDLGFSKLDHPVLW
Transcript ENSMUST00000071728
Sequence
GAGAACTGGTCGCGGGGATCGCACACCGGCCAGTAGCAGGGGACCAGGGACCCCGGCACCAGGAGAGCTGGTGCACTGCGCGGGCTCTCGCCCACCATCT

GTCTGCGAGCAGCGCTCGGCGCCCCAGTCTCCTGCGGCTGGTGCTGGAACTGCCGTCGGCTGAGACTTGCAGGGACCCGAGAAGCCCGGTTTGCGTCCTT

CTCGGTCTGAAGCACGCACTGGGGAATCGAGAAGCGTCCCCAGCAGCGGAACACTTAG - UNI32829 - GTCTGTCCTGTGTCAGCGAAGACCACGA

GAAGAGAGTCATGCAACATTGATCATACTGCCTGCCTTCTTTCGGAAGTATTGAACTTATTCAG - UNI28188 - - UNI32829 - AGATTTCCT

CTGAGACTTCCAGAATGGCTTCTAAACACATTGGGTAAGAGCTGGCACCTGCCTGCGAGGACTTCATACTCTCAGCTCCACCATCTTCCCATGGCATTTT

GACTGCGCTGAGCCCAAAGGACCAGCTCTTCACAATGAGTGACGAGAAGAATCTCGGTGTGTCTCAAAAGTTGGTTTCACCTTCAAGAAGCACAAGTAGT

TGCTCCTCCAAGCAAGGAAGCCGGCAG GACAGCTGGGAAGTCGTGGAAGGATTGAGAGGGGAAATGACTTACACCCAGGAGCCGCCAGTGCAGAAAGGA

TTTTTGCTGAAAAAGAGGAAGTGGCCCTTAAAAGGCTGGCACAAG AGATTCTTCTGCCTGGAAAAGGGAATCTTGAAATATGCCAAGAGCCAAGCTGAT

 ATTGAGCGGGAGAAGTTGCATGGCTGCATTGACGTGGGGCTCTCTGTGATGTCTGTGAAGAAGTCGTCTAAGTGTATCGACCTAGACACGGAGGAGCAC

ATCTACCACCTGAAG GTGAAGTCAGAAGAACTCTTTGACGAGTGGGTGTCCAAGCTCCGTCACCACAGAATGTACCGGCAGAATGAGATCGCCATGTTT

CCCCGGGATGTCAATCACTTTTTCTCAGGGTCCTCTGTCACAGATTCTGCCCCAGGAGTGTTCGAGTCAGTTTCCAGTAGGAAG CGTAGCAGTCTATCA

AAGCAGAATTCATTTCCACCCGGAAGCAATTTGTCATTTTCTTGTGGTGGCGACACTCGAGTTCCTTTCTGGCTACAGTCTTCAGAGGACATGGAAAAAT

GTTCAAAAG ACATGGCACACTGCCATGCCTACCTGCTGGAAATGAGCCAGCTCTTAGAAAGCATGGACGTCCTGCATCGGACATACTCGGCGCCAGCCA

TCAACGCCATCCAG GTCCCTAAGCCTTTTTCTGGCCCTGTGAGACTGCACTCCTCCAATCCTAACTTGTCGACGCTGGACTTTGGAGAAGAGAAGTCTT

ACTCGGATGGTTCTGAAGCCTCGTCGGAGTTCTCCAAGATGCAGGAGGATCTGTGCCATGTCGCCCACAAAG TTTACTTCGCTTTAAGGTCGGCTTTCA

ATAGCATATCGGTGGAGAGAGAGAAACTGAAGCAGCTGATGGAGCTGGACACCTCCCCCTCCCCCTCCGCTCAGGTCGTCGGGCTGAAGCACGCTCTGTC

ATCC GAAAACTCCAGGGATGAGGGCCGAGCCCTGGTGCACCAGCTCTCCAATGAGAGCAGGCTGTCTATCACCGACTCCCTTTCTGAGTTCTTCGATGC

CCAGGAAGTTCTGCTGTCTCCTAGCTCTTCAGAAAACGAG ATTTCTGATGATGATTCATACGTCAGTGACATAAGTGATAATCTGTCCTTAGACAACCT

CAGTAATGATTTAGACAATGAAAGACAGACCTTGG GGCCTGTTCTCGAGAGTAGTGGGGAAGCCAGATCCAAAAGGAGGACCAGCTTGCCGGCACCGGG

TCCCAACACCAGTAGCGTTAGCTTGTGGAGCATCCTGCGCAACAACATTGGGAAGGACCTGTCCAAGGTGGCCATGCCGGTGGAGCTGAACGAGCCCCTG

AACACGCTGCAGCGGCTCTGCGAGGAGCTGGAATACAGCGAGCTTCTGGACAAGGCCTCGAGAATCCCCAGTCCCCTGGAGAGGATG - UNI28013 -

 - UNI32341 - GTGTACGTAGCAGCCTTCGCCATCTCCGCATATGCATCCAGCTACTTCCGAGCAGGCAGCAAGCCGTTTAACCCGGTCCTTGGAGA

AACGTACGAATGCATCCGACAGGACAAGGGTTTCCAGTTTTTTGCCGAGCAG - UNI32341 - GTCAGCCACCACCCACCTATCTCCGCCTGCCACG

CTGAGTCCGGAAACTTTGTTTTCTGGCAAG - UNI32341 - ATGTGAGATGGAAAAATAAATTCTGGGGTAAATCCATGGAAATTGTCCCGATTGGC

ACAACCCACGTGACTCTGCCTGC TTTTGGAGATCACTTTGAGTGGAACAAAGTAACCTCCTGCATCCACAACATCTTGAGCGGACAGCGATGGATCGAG

CACTATGGCGAAATTGACATCAAGAACCTGAATGACGACTCCTGCCACTGCAAAGTGAACTTCATAAAG GCTAAGTACTGGAGCACTAATGCCCACGAG

ATCGAAGGCACGGTGTTCGACCGCAGTGGGAAGGCTGTGCACCGGCTGTTTGGGAAATGGCACGAGAGCATCTACTGTGGCGGCGCCTCCTCTTCCACAT

GCGTCTGGAGAGCAA ATCCCATGCCGAAAGGCTATGAGCAGTATTATGGCTTCACACAGTTTGCACTAGAGTTAAATGAAATGGATCCTTTGTCAAGGT

CTTTATTACCACCCACCGACACTCGGTTTAGACCAGATCAAAG GCTTCTAGAGGAAGGGAACATAGAGGAGGCTGAGGTTCAGAAGCAGAGGATCGAGA

AGCTGCAGAGAGAGCGGCGGAGGGTCTTGGAGGAGAACGGTGTGGAGCACCAGCCCCGGTTTTTCAG GAAATCCAGTGACGATGCTTGGGTAAGCAATG

GGACCTACCTGGAACTGAGGAAAGACCTTGGCTTTTCCAAGTTGGACCATCCCGTCTTATGGTGAAATGTAAAAGAGAAGGAGATTTCCTGTAACTTTGC

CCACATTTGCTTCCGGAAGCAGCGCACAGCTGTCTGTATGTTTAAAAGATAGCATCTAGAATGATCACTTGTGCTTAGCGTAGCATTGTAAGCGCTGAAG

TATATATTTTCTTCAGTAAGTCTCTTTAAAATTTCAAGTGTTATCATGATTGTTTATATGAATGTAGAACACCTCGGTATTTCTTTTTATATATATAAAC

TATTTAATAAAAATGAAAGATTGAATGTT
Translation
 - UNI32829 -  - UNI28188 - - UNI32829 - MSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQ DSWEVVEGLRGEMTYTQEPPVQKGFLL

KKRKWPLKGWHK RFFCLEKGILKYAKSQAD IEREKLHGCIDVGLSVMSVKKSSKCIDLDTEEHIYHLK VKSEELFDEWVSKLRHHRMYRQNEIAMFP

RDVNHFFSGSSVTDSAPGVFESVSSRK RSSLSKQNSFPPGSNLSFSCGGDTRVPFWLQSSEDMEKCSKD DMAHCHAYLLEMSQLLESMDVLHRTYSAP

AINAIQ VPKPFSGPVRLHSSNPNLSTLDFGEEKSYSDGSEASSEFSKMQEDLCHVAHKV VYFALRSAFNSISVEREKLKQLMELDTSPSPSAQVVGLK

HALSS ENSRDEGRALVHQLSNESRLSITDSLSEFFDAQEVLLSPSSSENE ISDDDSYVSDISDNLSLDNLSNDLDNERQTLG GPVLESSGEARSKRR

TSLPAPGPNTSSVSLWSILRNNIGKDLSKVAMPVELNEPLNTLQRLCEELEYSELLDKASRIPSPLERM - UNI28013 - - UNI32341 - VYVA

AFAISAYASSYFRAGSKPFNPVLGETYECIRQDKGFQFFAEQ - UNI32341 - VSHHPPISACHAESGNFVFWQD - UNI32341 - DVRWKNKF

WGKSMEIVPIGTTHVTLPA AFGDHFEWNKVTSCIHNILSGQRWIEHYGEIDIKNLNDDSCHCKVNFIK AKYWSTNAHEIEGTVFDRSGKAVHRLFGKW

HESIYCGGASSSTCVWRAN NPMPKGYEQYYGFTQFALELNEMDPLSRSLLPPTDTRFRPDQR RLLEEGNIEEAEVQKQRIEKLQRERRRVLEENGVEH

QPRFFR RKSSDDAWVSNGTYLELRKDLGFSKLDHPVLW
Transcript ENSMUST00000114469
Sequence
GAGAACTGGTCGCGGGGATCGCACACCGGCCAGTAGCAGGGGACCAGGGACCCCGGCACCAGGAGAGCTGGTGCACTGCGCGGGCTCTCGCCCACCATCT

GTCTGCGAGCAGCGCTCGGCGCCCCAGTCTCCTGCGGCTGGTGCTGGAACTGCCGTCGGCTGAGACTTGCAGGGACCCGAGAAGCCCGGTTTGCGTCCTT

CTCGGTCTGAAGCACGCACTGGGGAATCGAGAAGCGTCCCCAGCAGCGGAACACTTAG - UNI32829 - GTCTGTCCTGTGTCAGCGAAGACCACGA

GAAGAGAGTCATGCAACATTGATCATACTGCCTGCCTTCTTTCGGAAGTATTGAACTTATTCAG - UNI28188 - - UNI32829 - AGATTTCCT

CTGAGACTTCCAGAATGGCTTCTAAACACATTGGGTAAGAGCTGGCACCTGCCTGCGAGGACTTCATACTCTCAGCTCCACCATCTTCCCATGGCATTTT

GACTGCGCTGAGCCCAAAGGACCAGCTCTTCACAATGAGTGACGAGAAGAATCTCGGTGTGTCTCAAAAGTTGGTTTCACCTTCAAGAAGCACAAGTAGT

TGCTCCTCCAAGCAAGGAAGCCGGCAG GACAGCTGGGAAGTCGTGGAAGGATTGAGAGGGGAAATGACTTACACCCAGGAGCCGCCAGTGCAGAAAGGA

TTTTTGCTGAAAAAGAGGAAGTGGCCCTTAAAAGGCTGGCACAAG AGATTCTTCTGCCTGGAAAAGGGAATCTTGAAATATGCCAAGAGCCAAGCTGAT

 ATTGAGCGGGAGAAGTTGCATGGCTGCATTGACGTGGGGCTCTCTGTGATGTCTGTGAAGAAGTCGTCTAAGTGTATCGACCTAGACACGGAGGAGCAC

ATCTACCACCTGAAG GTGAAGTCAGAAGAACTCTTTGACGAGTGGGTGTCCAAGCTCCGTCACCACAGAATGTACCGGCAGAATGAGATCGCCATGTTT

CCCCGGGATGTCAATCACTTTTTCTCAGGGTCCTCTGTCACAGATTCTGCCCCAGGAGTGTTCGAGTCAGTTTCCAGTAGGAAG CGTAGCAGTCTATCA

AAGCAGAATTCATTTCCACCCGGAAGCAATTTGTCATTTTCTTGTGGTGGCGACACTCGAGTTCCTTTCTGGCTACAGTCTTCAGAGGACATGGAAAAAT

GTTCAAAAG ACATGGCACACTGCCATGCCTACCTGCTGGAAATGAGCCAGCTCTTAGAAAGCATGGACGTCCTGCATCGGACATACTCGGCGCCAGCCA

TCAACGCCATCCAG GTCCCTAAGCCTTTTTCTGGCCCTGTGAGACTGCACTCCTCCAATCCTAACTTGTCGACGCTGGACTTTGGAGAAGAGAAGTCTT

ACTCGGATGGTTCTGAAGCCTCGTCGGAGTTCTCCAAGATGCAGGAGGATCTGTGCCATGTCGCCCACAAAG TTTACTTCGCTTTAAGGTCGGCTTTCA

ATAGCATATCGGTGGAGAGAGAGAAACTGAAGCAGCTGATGGAGCTGGACACCTCCCCCTCCCCCTCCGCTCAGGTCGTCGGGCTGAAGCACGCTCTGTC

ATCC GCCCTAGCACAAAACACAGATCTTAAAGAACGCTTACGCAGAATCCATGCGGAATCTCTGCTCCTCGACCCGCCCGCTGTTCCCAAGCCGGGGGA

CAACCTGGCAGAG GAAAACTCCAGGGATGAGGGCCGAGCCCTGGTGCACCAGCTCTCCAATGAGAGCAGGCTGTCTATCACCGACTCCCTTTCTGAGTT

CTTCGATGCCCAGGAAGTTCTGCTGTCTCCTAGCTCTTCAGAAAACGAG ATTTCTGATGATGATTCATACGTCAGTGACATAAGTGATAATCTGTCCTT

AGACAACCTCAGTAATGATTTAGACAATGAAAGACAGACCTTGG GGCCTGTTCTCGAGAGTAGTGGGGAAGCCAGATCCAAAAGGAGGACCAGCTTGCC

GGCACCGGGTCCCAACACCAGTAGCGTTAGCTTGTGGAGCATCCTGCGCAACAACATTGGGAAGGACCTGTCCAAGGTGGCCATGCCGGTGGAGCTGAAC

GAGCCCCTGAACACGCTGCAGCGGCTCTGCGAGGAGCTGGAATACAGCGAGCTTCTGGACAAGGCCTCGAGAATCCCCAGTCCCCTGGAGAGGATG - U

NI28013 - - UNI32341 - GTGTACGTAGCAGCCTTCGCCATCTCCGCATATGCATCCAGCTACTTCCGAGCAGGCAGCAAGCCGTTTAACCCGGT

CCTTGGAGAAACGTACGAATGCATCCGACAGGACAAGGGTTTCCAGTTTTTTGCCGAGCAG - UNI32341 - GTCAGCCACCACCCACCTATCTCCG

CCTGCCACGCTGAGTCCGGAAACTTTGTTTTCTGGCAAG - UNI32341 - ATGTGAGATGGAAAAATAAATTCTGGGGTAAATCCATGGAAATTGTC

CCGATTGGCACAACCCACGTGACTCTGCCTGC TTTTGGAGATCACTTTGAGTGGAACAAAGTAACCTCCTGCATCCACAACATCTTGAGCGGACAGCGA

TGGATCGAGCACTATGGCGAAATTGACATCAAGAACCTGAATGACGACTCCTGCCACTGCAAAGTGAACTTCATAAAG GCTAAGTACTGGAGCACTAAT

GCCCACGAGATCGAAGGCACGGTGTTCGACCGCAGTGGGAAGGCTGTGCACCGGCTGTTTGGGAAATGGCACGAGAGCATCTACTGTGGCGGCGCCTCCT

CTTCCACATGCGTCTGGAGAGCAA ATCCCATGCCGAAAGGCTATGAGCAGTATTATGGCTTCACACAGTTTGCACTAGAGTTAAATGAAATGGATCCTT

TGTCAAGGTCTTTATTACCACCCACCGACACTCGGTTTAGACCAGATCAAAG GCTTCTAGAGGAAGGGAACATAGAGGAGGCTGAGGTTCAGAAGCAGA

GGATCGAGAAGCTGCAGAGAGAGCGGCGGAGGGTCTTGGAGGAGAACGGTGTGGAGCACCAGCCCCGGTTTTTCAG GAAATCCAGTGACGATGCTTGGG

TAAGCAATGGGACCTACCTGGAACTGAGGAAAGACCTTGGCTTTTCCAAGTTGGACCATCCCGTCTTATGGTGAAATGTAAAAGAGAAGGAGATTTCCTG

TAACTTTGCCCACATTTGCTTCCGGAAGCAGCGCACAGCTGTCTGTATGTTTAAAAGATAGCATCTAGAATGATCACTTGTGCTTAGCGTAGCATTGTAA

GCGCTGAAGTATATATTTTCTTCAGTAAGTCTCTTTAAAATTTCAAGTGTTATCATGATTGTTTATATGAATGTAGAACACCTCGGTATTTCTTTTTATA

TATATAAACTATTTAATAAAAATGAAAGATTGAATGTT
Translation
 - UNI32829 -  - UNI28188 - - UNI32829 - MSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQ DSWEVVEGLRGEMTYTQEPPVQKGFLL

KKRKWPLKGWHK RFFCLEKGILKYAKSQAD IEREKLHGCIDVGLSVMSVKKSSKCIDLDTEEHIYHLK VKSEELFDEWVSKLRHHRMYRQNEIAMFP

RDVNHFFSGSSVTDSAPGVFESVSSRK RSSLSKQNSFPPGSNLSFSCGGDTRVPFWLQSSEDMEKCSKD DMAHCHAYLLEMSQLLESMDVLHRTYSAP

AINAIQ VPKPFSGPVRLHSSNPNLSTLDFGEEKSYSDGSEASSEFSKMQEDLCHVAHKV VYFALRSAFNSISVEREKLKQLMELDTSPSPSAQVVGLK

HALSS ALAQNTDLKERLRRIHAESLLLDPPAVPKPGDNLAE ENSRDEGRALVHQLSNESRLSITDSLSEFFDAQEVLLSPSSSENE ISDDDSYVSDI

SDNLSLDNLSNDLDNERQTLG GPVLESSGEARSKRRTSLPAPGPNTSSVSLWSILRNNIGKDLSKVAMPVELNEPLNTLQRLCEELEYSELLDKASRIP

SPLERM - UNI28013 - - UNI32341 - VYVAAFAISAYASSYFRAGSKPFNPVLGETYECIRQDKGFQFFAEQ - UNI32341 - VSHHPPI

SACHAESGNFVFWQD - UNI32341 - DVRWKNKFWGKSMEIVPIGTTHVTLPA AFGDHFEWNKVTSCIHNILSGQRWIEHYGEIDIKNLNDDSCHC

KVNFIK AKYWSTNAHEIEGTVFDRSGKAVHRLFGKWHESIYCGGASSSTCVWRAN NPMPKGYEQYYGFTQFALELNEMDPLSRSLLPPTDTRFRPDQR

 RLLEEGNIEEAEVQKQRIEKLQRERRRVLEENGVEHQPRFFR RKSSDDAWVSNGTYLELRKDLGFSKLDHPVLW
Transcript ENSMUST00000114470
Sequence
GAGAACTGGTCGCGGGGATCGCACACCGGCCAGTAGCAGGGGACCAGGGACCCCGGCACCAGGAGAGCTGGTGCACTGCGCGGGCTCTCGCCCACCATCT

GTCTGCGAGCAGCGCTCGGCGCCCCAGTCTCCTGCGGCTGGTGCTGGAACTGCCGTCGGCTGAGACTTGCAGGGACCCGAGAAGCCCGGTTTGCGTCCTT

CTCGGTCTGAAGCACGCACTGGGGAATCGAGAAGCGTCCCCAGCAGCGGAACACTTAG - UNI32829 - GTCTGTCCTGTGTCAGCGAAGACCACGA

GAAGAGAGTCATGCAACATTGATCATACTGCCTGCCTTCTTTCGGAAGTATTGAACTTATTCAG - UNI28188 - - UNI32829 - AGATTTCCT

CTGAGACTTCCAGAATGGCTTCTAAACACATTGGGTAAGAGCTGGCACCTGCCTGCGAGGACTTCATACTCTCAGCTCCACCATCTTCCCATGGCATTTT

GACTGCGCTGAGCCCAAAGGACCAGCTCTTCACAATGAGTGACGAGAAGAATCTCGGTGTGTCTCAAAAGTTGGTTTCACCTTCAAGAAGCACAAGTAGT

TGCTCCTCCAAGCAAGGAAGCCGGCAG GACAGCTGGGAAGTCGTGGAAGGATTGAGAGGGGAAATGACTTACACCCAGGAGCCGCCAGTGCAGAAAGGA

TTTTTGCTGAAAAAGAGGAAGTGGCCCTTAAAAGGCTGGCACAAG AGATTCTTCTGCCTGGAAAAGGGAATCTTGAAATATGCCAAGAGCCAAGCTGAT

 ATTGAGCGGGAGAAGTTGCATGGCTGCATTGACGTGGGGCTCTCTGTGATGTCTGTGAAGAAGTCGTCTAAGTGTATCGACCTAGACACGGAGGAGCAC

ATCTACCACCTGAAG GTGAAGTCAGAAGAACTCTTTGACGAGTGGGTGTCCAAGCTCCGTCACCACAGAATGTACCGGCAGAATGAGATCGCCATGTTT

CCCCGGGATGTCAATCACTTTTTCTCAGGGTCCTCTGTCACAGATTCTGCCCCAGGAGTGTTCGAGTCAGTTTCCAGTAGGAAG CGTAGCAGTCTATCA

AAGCAGAATTCATTTCCACCCGGAAGCAATTTGTCATTTTCTTGTGGTGGCGACACTCGAGTTCCTTTCTGGCTACAGTCTTCAGAGGACATGGAAAAAT

GTTCAAAAG ACATGGCACACTGCCATGCCTACCTGCTGGAAATGAGCCAGCTCTTAGAAAGCATGGACGTCCTGCATCGGACATACTCGGCGCCAGCCA

TCAACGCCATCCAG GGTGGAGCTTTTGAAAGTCCCAAAAAGGAAAAACGACCACACAGGAGGTGGCGGTCCAGAGCTATTGGCAAAGATGCTAAAGGAA

CGCTGCAG GTCCCTAAGCCTTTTTCTGGCCCTGTGAGACTGCACTCCTCCAATCCTAACTTGTCGACGCTGGACTTTGGAGAAGAGAAGTCTTACTCGG

ATGGTTCTGAAGCCTCGTCGGAGTTCTCCAAGATGCAGGAGGATCTGTGCCATGTCGCCCACAAAG TTTACTTCGCTTTAAGGTCGGCTTTCAATAGCA

TATCGGTGGAGAGAGAGAAACTGAAGCAGCTGATGGAGCTGGACACCTCCCCCTCCCCCTCCGCTCAGGTCGTCGGGCTGAAGCACGCTCTGTCATCC G

CCCTAGCACAAAACACAGATCTTAAAGAACGCTTACGCAGAATCCATGCGGAATCTCTGCTCCTCGACCCGCCCGCTGTTCCCAAGCCGGGGGACAACCT

GGCAGAG GAAAACTCCAGGGATGAGGGCCGAGCCCTGGTGCACCAGCTCTCCAATGAGAGCAGGCTGTCTATCACCGACTCCCTTTCTGAGTTCTTCGA

TGCCCAGGAAGTTCTGCTGTCTCCTAGCTCTTCAGAAAACGAG ATTTCTGATGATGATTCATACGTCAGTGACATAAGTGATAATCTGTCCTTAGACAA

CCTCAGTAATGATTTAGACAATGAAAGACAGACCTTGG GGCCTGTTCTCGAGAGTAGTGGGGAAGCCAGATCCAAAAGGAGGACCAGCTTGCCGGCACC

GGGTCCCAACACCAGTAGCGTTAGCTTGTGGAGCATCCTGCGCAACAACATTGGGAAGGACCTGTCCAAGGTGGCCATGCCGGTGGAGCTGAACGAGCCC

CTGAACACGCTGCAGCGGCTCTGCGAGGAGCTGGAATACAGCGAGCTTCTGGACAAGGCCTCGAGAATCCCCAGTCCCCTGGAGAGGATG - UNI2801

3 - - UNI32341 - GTGTACGTAGCAGCCTTCGCCATCTCCGCATATGCATCCAGCTACTTCCGAGCAGGCAGCAAGCCGTTTAACCCGGTCCTTGG

AGAAACGTACGAATGCATCCGACAGGACAAGGGTTTCCAGTTTTTTGCCGAGCAG - UNI32341 - GTGAGATGGAAAAATAAATTCTGGGGTAAAT

CCATGGAAATTGTCCCGATTGGCACAACCCACGTGACTCTGCCTGC TTTTGGAGATCACTTTGAGTGGAACAAAGTAACCTCCTGCATCCACAACATCT

TGAGCGGACAGCGATGGATCGAGCACTATGGCGAAATTGACATCAAGAACCTGAATGACGACTCCTGCCACTGCAAAGTGAACTTCATAAAG GCTAAGT

ACTGGAGCACTAATGCCCACGAGATCGAAGGCACGGTGTTCGACCGCAGTGGGAAGGCTGTGCACCGGCTGTTTGGGAAATGGCACGAGAGCATCTACTG

TGGCGGCGCCTCCTCTTCCACATGCGTCTGGAGAGCAA ATCCCATGCCGAAAGGCTATGAGCAGTATTATGGCTTCACACAGTTTGCACTAGAGTTAAA

TGAAATGGATCCTTTGTCAAGGTCTTTATTACCACCCACCGACACTCGGTTTAGACCAGATCAAAG GCTTCTAGAGGAAGGGAACATAGAGGAGGCTGA

GGTTCAGAAGCAGAGGATCGAGAAGCTGCAGAGAGAGCGGCGGAGGGTCTTGGAGGAGAACGGTGTGGAGCACCAGCCCCGGTTTTTCAG GAAATCCAG

TGACGATGCTTGGGTAAGCAATGGGACCTACCTGGAACTGAGGAAAGACCTTGGCTTTTCCAAGTTGGACCATCCCGTCTTATGGTGAAATGTAAAAGAG

AAGGAGATTTCCTGTAACTTTGCCCACATTTGCTTCCGGAAGCAGCGCACAGCTGTCTGTATGTTTAAAAGATAGCATCTAGAATGATCACTTGTGCTTA

GCGTAGCATTGTAAGCGCTGAAGTATATATTTTCTTCAGTAAGTCTCTTTAAAATTTCAAGTGTTATCATGATTGTTTATATGAATGTAGAACACCTCGG

TATTTCTTTTTATATATATAAACTATTTAATAAAAATGAAAGATTGAATGTT
Translation
 - UNI32829 -  - UNI28188 - - UNI32829 - MSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQ DSWEVVEGLRGEMTYTQEPPVQKGFLL

KKRKWPLKGWHK RFFCLEKGILKYAKSQAD IEREKLHGCIDVGLSVMSVKKSSKCIDLDTEEHIYHLK VKSEELFDEWVSKLRHHRMYRQNEIAMFP

RDVNHFFSGSSVTDSAPGVFESVSSRK RSSLSKQNSFPPGSNLSFSCGGDTRVPFWLQSSEDMEKCSKD DMAHCHAYLLEMSQLLESMDVLHRTYSAP

AINAIQ GGAFESPKKEKRPHRRWRSRAIGKDAKGTLQ VPKPFSGPVRLHSSNPNLSTLDFGEEKSYSDGSEASSEFSKMQEDLCHVAHKV VYFALRS

AFNSISVEREKLKQLMELDTSPSPSAQVVGLKHALSS ALAQNTDLKERLRRIHAESLLLDPPAVPKPGDNLAE ENSRDEGRALVHQLSNESRLSITDS

LSEFFDAQEVLLSPSSSENE ISDDDSYVSDISDNLSLDNLSNDLDNERQTLG GPVLESSGEARSKRRTSLPAPGPNTSSVSLWSILRNNIGKDLSKVA

MPVELNEPLNTLQRLCEELEYSELLDKASRIPSPLERM - UNI28013 - - UNI32341 - VYVAAFAISAYASSYFRAGSKPFNPVLGETYECIR

QDKGFQFFAEQ - UNI32341 - VRWKNKFWGKSMEIVPIGTTHVTLPA AFGDHFEWNKVTSCIHNILSGQRWIEHYGEIDIKNLNDDSCHCKVNFI

K AKYWSTNAHEIEGTVFDRSGKAVHRLFGKWHESIYCGGASSSTCVWRAN NPMPKGYEQYYGFTQFALELNEMDPLSRSLLPPTDTRFRPDQR RLLE

EGNIEEAEVQKQRIEKLQRERRRVLEENGVEHQPRFFR RKSSDDAWVSNGTYLELRKDLGFSKLDHPVLW

For any suggestions or comments, please send an email to unitrap@crg.es