Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029843 (Slc13a4)
Chromosomal location
Chr 6: 35217958 - 35258126 (-)
Description
solute carrier family 13 (sodium/sulfate symporters), member 4 Gene [Source:MGI (curated);Acc:Slc13a4-001]
RefSeq_dna
NM_172892 
RefSeq_peptide
NP_766480.1 
UniGene
Mm.23666 Mm.403195 
MGI
MGI:2442367 
Uniprot/SPTREMBL
Q3UTH1 Q5FWX9 Q8BZ82 
Human Ortholog
ENSG00000164707 (SLC13A4)
Omim not available
UniTrap UNI26204
Vector Insertion
Chr 6: 35237918 - 35239793
Public Clones not available
Private Clones OST130881 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14110
Vector Insertion
Chr 6: 35218969 - 35220343
Public Clones CMHD-GT_106A8-3 (cmhd) CMHD-GT_398E4-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000031868
Sequence
GATTCTTCACGGCTGCTTTGGAAGTCCATACTTCAGGAAAAGTATAAGTAGGAGCCCAATTTGAAGGGAAGAAATCTAAACAGAATTAAGGTGTCAGGTA

CTGAGAGAGAGAGAGTGCACCCTCAGACTGACACCAGTGCTGGCTTTAAGGGAAGGGGCCAACAGATTTTTTTTTTTTTACCAACAGTCAGCCAGGTCGG

AGGTAAGACAAAACAGGTCACCAGAAAGAAGAAAAGCTACTGTGGTTTTGGGGTTTTTGTTTTGTTTTGTTTTGTTTTGTTTTGTTTTTAAGCTTTAAAT

GATTCTTCAATACTGACCAGTAGCCGCAAGCTCATTGCTCCCGAGGACTCTTTCTGGCGTCTAGCATGAAGCCACCCTCTTGTTAACCAGAGAGAAAACC

CAGCGCTCAGGTGTGTAAGCCTTTCCCGGCTCTTCTTCGATGGCCATAACACTATGCTGCTCAACCTCACCTAAGGCAAAAGTCAAGCAGCCCAGCTTTC

TGTGGAAACTGGGTGCAGCCACCCTGCTTCTCTGCTCCCGAGACCAAAGAGGACTAACTCTTGGAAGCCAGGGAAGGTGTGTGAAGTCTTCCTGGACGGA

GAGGGGAGCGTAGCGCAGAACAGAAGAGGACGCCATTGAGGACTCGATCCAGGATCCAGACAGGTCCACCATGGGCTTGCTGCAGGGCCTTCTCCAAGCG

AGGAAGCTGCTATTGGTCATCTGTGTGCCGCTGCTGCTGCTGCCTCTGCCCACCATCTACCCCACCAGC GAAGCTGCGTGTGCTTACGTGTTGCTTGTG

ACCGCTGTGTACTGGGTGTCTGAGGCCGTGCCTCTCGGAGCTGCAGCCCTCGTGCCTGCCTTCCTCTACCCGTTCTTCGGTGTTCTCCGATCCAGTGAG 

GTGGCGGCTGAGTACTTCAAGAACACCACGCTGCTGTTGGTGGGCGTCATCTGTGTGGCAGCAGCTGTGGAGAAGTGGAATTTACACAAGCGCATCGCCC

TGCGCATGGTCTTGATGGCGGGAGCCAAGCCTGGCAT - UNI26204 - GCTCCTGCTGTGTTTCATGTGCTGTACCACCATGCTGTCCATGTGGCTC

TCCAACACCTCCACCACCGCCATGGTGATGCCCATCGTGGAGGCGGTGCTGCAGGAGCTCATCAACGCTGAGGAGGAACAGCTGGCAGCCGGCACTGAGG

AGGCTGAGCTCATGG GTCTTGATGTAAACAACAGACAGACGTCCATGGAACTCATCTTTGTCAATGAAGA CACGTCGGCTGCAGACTTCACTTCTCTG

ATGCAGAGCAAG AATCTGAATGGTGTGCCCATGGTCACCAAATCCATCAACACAGCAAACCAACAGCAACAGAAGAAGCAGCAGCCGTCACAG GAAAA

GCCAGGAGTCCCAACCCCCAGCTCCAAGACCCAAGAACTGAACAAGAAGAAGTACAGATCCCACCATGACCAAATGATCTGCAAGTGCCTTTCTCTGAGC

ATTTCCTATGCTGCCACCATTGGTGGCCTGACCACCATCATAGGCACCTCCACCAGCCTCATTTTCTTAGAGCATTTCAACAA CCAGTACCCGGCGGCA

GAGGTGGTGAACTTCGGAACCTGGTTCCTCTTCAGCTTCCCCATCTCGCTCATCATGCTGGTGGTCAGCTGGTTCTGGATCCACTGGCTCTTCCTGGGCT

GCAA CTTCAAAGAGACCTGCTCTCTGAGCAAGAAGAAGAAGACCAGGAGGGAGGAGCTATCAGAGAAGAGGATCCGGGAGGAATATGAGAAGCTAGGAG

ACATTAG CTACCCTGAGATGGTGACCGCCTTTTTCTTCATTCTGATGACGGTGCTGTGGTTTACCCGGGAGCCCGGCTTTGTCCCTGGCTGGGATTCTT

TCTTTGAAAA GAAAGGCTACCGCACTGATGCCACAGTCTCTGTATTCCTTGGCTTCCTGCTTTTCCTCATTCCAGCAAAGAAGCCCTGCTTTGGGAAAA

AGAGTGATG GAACAGGCCAGGAAGCCTCCAAAGGGATAGAGCCCATCATCACGTGGAAGGACTTCCAGAAAACTATGCCCTGGGAGATTGTCATTCTGG

TGGGAGGAGGCTACGCCCTGGCTTCTGGCAGCAAG AGCTCTGGCCTCTCCACATGGATCGGGCACCAGATGCTGTCCCTGAGCAGCCTCCCGCCATGGG

CTATCACCCTGCTGGCGTGTGTCCTGGTGTCCATTGTCACGGAGTTTGTCAGCAATCCAGCCACCATCACCATCTTCCTGCCCATCCTTTGTACCCTG T

CCGAAACGCTGCACATCAATCCACTGTACACCCTGGTCCCCGTTACCATGTCAATCTCCTTCGCTGTGATGCTGCCCGTGGGCAACCCCCCCAACGCCAT

CGTCTTCAGCTACGGGCACTGCCAGATCAAAGACATG - UNI14110 - GTGAAAGCCGGTCTGGGAGTCAATGTCATCGGTCTGGTGATCGTGATGG

TGGCCATCAATACTTGGGGAGTTAGCCTCTTCCACTTGGATGCTTTCCCAGCCTGGGCTAAGGTCAGCAACATCACTGATCAGACCTAACGCGAGCGGAC

AGTTACCAAGCACAGCCAGAGCTAAGCCTTGGGCCGAGAAAACCACCAGAAGCATAAACCCCAGACCCACATGGAGGCTATTCCCGCCGCCAGATCCCGC

CAACCGCCACCGGGCGCATTGGCTGTGTCTCCCTCCCAGCCTGCCTGCTTTTCTTACCACCAACTCTCAAGAAAGCCTACAGCTGCTCTCTCTTCCTGTG

TCCAGCTCTCTCTTTTTGAAGACCAGAAAACACTGTAAGCCTTGGTGCCCTGAGAGGAAACCTCACAAACTGACCGGCATCACTAGGTTTTGTGTCACCT

TCCTAGGAATCAGAGCTAGCCAGAGCACTCTGCCTGTCAGACCATGAGACCTGTGACCTCTCTTCTGGGAGAAAACCTCACCCATGTTCTCAAGCATTTC

TGTCCTATCTCTAGAAAAGGTAACCTGTCTCTCTTCAGTGGTCCCCCTACCTCGGCACCAAATTCCTGAAAAGAAATAATATTCTCCTTCAGAAGGAGGC

TGGCCTGATTCCACCAAAGGAAAGAGATGGAAACAAACCAACCAACCATCCTGAGGTCAGCTTCTCTATGCACTGTCATTAACAGGAGATTCTATTGTGT

TGTGTGTGGTGAGAGGAAAAAGGTTCATACCTGTCTTATTAGGAAGACCACAACTACAATTAAGACCACAGTATTAACTGATATTACATCTACTTCTCCA

TTTAATAACTAGCTTGTTTCTGAGAAAACCAAGTTCTAAGTGGTACCCAAAGGTGTTGCCAGTCCTTCCTATGCATCCACGAGCCCTTTGAGGGGAGAGA

TGTGCCTTGGGTTCTTTACAATGTATTAAACTCTAACTGCTCAATAAATGTCTCTGATGACT
Translation
MGLLQGLLQARKLLLVICVPLLLLPLPTIYPTS EAACAYVLLVTAVYWVSEAVPLGAAALVPAFLYPFFGVLRSSE VAAEYFKNTTLLLVGVICVAAA

VEKWNLHKRIALRMVLMAGAKPGM - UNI26204 - MLLLCFMCCTTMLSMWLSNTSTTAMVMPIVEAVLQELINAEEEQLAAGTEEAELMG GLDVN

NRQTSMELIFVNED DTSAADFTSLMQSK NLNGVPMVTKSINTANQQQQKKQQPSQ EKPGVPTPSSKTQELNKKKYRSHHDQMICKCLSLSISYAATI

GGLTTIIGTSTSLIFLEHFNN NQYPAAEVVNFGTWFLFSFPISLIMLVVSWFWIHWLFLGCN NFKETCSLSKKKKTRREELSEKRIREEYEKLGDIS 

SYPEMVTAFFFILMTVLWFTREPGFVPGWDSFFEK KKGYRTDATVSVFLGFLLFLIPAKKPCFGKKSDG GTGQEASKGIEPIITWKDFQKTMPWEIVI

LVGGGYALASGSK SSGLSTWIGHQMLSLSSLPPWAITLLACVLVSIVTEFVSNPATITIFLPILCTL SETLHINPLYTLVPVTMSISFAVMLPVGNPP

NAIVFSYGHCQIKDM - UNI14110 - VKAGLGVNVIGLVIVMVAINTWGVSLFHLDAFPAWAKVSNITDQT

For any suggestions or comments, please send an email to unitrap@crg.es