Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030031 (Kbtbd8)
Chromosomal location
Chr 6: 95067874 - 95079712 (+)
Description
kelch repeat and BTB (POZ) domain containing 8 Gene [Source:MGI (curated);Acc:Kbtbd8-002]
RefSeq_peptide
NP_001096140.1 NP_001008785.2 
UniGene
Mm.402460 Mm.333275 
MGI
MGI:2661430 
Uniprot/SWISSPROT
Q3UQV5 
Human Ortholog
ENSG00000163376 (KBTBD8)
Omim not available
UniTrap UNI35177
Vector Insertion
Chr 6: 95067969 - 95068516
Public Clones IST10456D4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32201
Vector Insertion
Chr 6: 95072842 - 95076470
Public Clones IST13633C8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000119582
Sequence
AGCAGAGCCGGAACCCGGGAGCGAGCGAAACGCAATGACATTTCCTCTTTAAATAACCGGAGCCGGGGCCCCTGTAGTAATGGCCGCGTCGGCAG - UN

I35177 - ATCCATGTTCACTAGCGGCCTTACAGAAAGTACTCAGAAAGAAGTTCGAATCATTGGTGTTGAAGCTGAATCAATGGATTTAGTATTGAAT

TATGCCTATACCTCTAGAGTTATTCTGACAGAGGCCAATGTTCAAGCCTTGTTCACTACAGCTAGCATCTTCCAAATTCCTTCCATACAAGACCAGTGTG

CTAAGTATATGATTAGTCATTTGGATCCACAGAATTCTATTGGAGTCTTTATCTTTGCTGATCATTATGGTCATCAGGAGCTTGGAGATCGATCAAAAGA

ATATATCCGTAAAAAGTTTCTGTGTGTCACCAAAGAACAAGAGTTTCTCCAACTGACAAAAGACCAACTCATAAGCATACTAGACAGTGACGATTTAAAT

GTGGATCGGGAAGAACATGTTTATGAAAGCATTATAAGGTGGTTTGAACATGAGCAGAGTGAAAGAGAAGTACACCTTCCAGAGATTTTTGCCAAATGTA

TACGTTTTCCTCTAATGGAAGATACATTTATCGAGAAAATTCCTCCTCAGTTTGCACAGGCCATAGTCAAAAGTTGTGGAGAACCCTCCAACACCAGTGG

CTGTACACAGAGGCTTGGAATGACTGCTTCTGAAATGATCATATGTTTTGATGCTGCCCACAAACACTCAGGAAAGAAGCAAACAGTGCCTTGTCTAGAT

ATCGTCACAGGAAGAGTGTTTAAACTATGCAAACCACCAAATGACCTAAGAGAAGTTGGGATTCTTGTGTCACCAGATAATGACATATACATTGCAGGAG

GCTACAGGCCAAGCAGCAGTGAGGTGTCCATCGACCATAAAGCAGAAAATGATTTTTGGATGTATGACCATTCCACCAACAGATGGCTTTCCAAGCCGTC

CTTGCTTCGGGCCAGAATAGGCTGCAAGCTAGTATACTGCTGTGGTAAAATGTATGCAATTGGAGGGCGTGTTTACGAAGGTGATGGAAGAAACTCACTG

AAGTCTGTGGAGTGCTATGATAGCAGAGAGAATTGCTGGATGACTGTGTGTGCCATGCCAGTTGCAATGGAGTTTCATAATGCTGTGGAGCACAAAGAGA

AAATCTACGTTTTACAGG - UNI32201 - GGGAATTTTTCCTCTTCTATGAGCCTCAAAAAGACTACTGGGGATTTTTAACCCCCATGACTGTGCCT

CGAATCCAGGGCTTAGCAGCTGTGTACAAAGACTCAATCTACTACATAGCTGGAACCTGTGGAAATCATCAGCGTGTGTTTACTGTTGAAGCCTATGATA

TAGAGCTAAATAAGTGGACTCGTAAAAAGGACTTTCCGTGTGATCAGTCTATAAATCCATACCTGAAGCTAGTACTTTTCCAGAATAAACTCCATTTATT

TGTGCGAGCTACTCAAGTGACTGTTGAAGAACATATCTTCAGAACCAGCAGGAAAAATTCTCTTTACCAATACGATGACATTGCTGACCAGTGGATGAAA

GTGTATGAGACCCCAGATCGGCTGTGGGACCTTGGCCGCCATTTTGAGTGTGCGGTGGCTAAACTCTATCCTCAGTGTCTTCAGAAAGTTCTTTAAATAA

GCAGCAGGCCAAAGCACGCCCCTGGCATCTCATACTGAGGAAGCTGGCTTAGGAAATGCTGTCGCCATTGAAGAAAGCTAACAGAGTCTTGTATTCAGAA

ATGGGTGCTCATAAAGACTGTGGTGTGGAGAGGGATTTGATTTTACCTTCATGATATTTTCAGTTCAGTCAGGAAAGGGAACAAAGTGCGGTTATCAGCA

TTTTTCCACCCCTGGCATAAAAGTATCATCCTAGAGTTTTGTGATAAATAGTTGCTGAGAAACCAGGTGAATTCAAGACAACTATGCACTCTTGAAAAGC

AGAATATTCCTGGGTAGAGACATCCAAACTGGTTAACGTGACTTTCTTTTAACTACGGGTAACAATATGAGGCAATATCATTTATTTAGCTGTGATCTCT

AACACAGAGAAGCACTAACCTAGATCCTCAGTCTTACTATTTATATCTATTTACATATATATTTTTGTGTACTGTTTTCAAGTGTACGAGATTTAAATGT

GCTGTCAGCAGACGGAAGGGAAACTCGGTTTTCAGAGCGAACTTTTAGTCCGATTGTTCCATGTAACTTTTAAGTTAAGCTGCAAGGTTAAAGTGGCAGT

TTTCTGTCCATAACTTTTTCAAGTGCTAACACTGTCTCATTTTTTAAAATCCCAGAAAGGGCTCAGATTTGCAGGTGACTGGTGCTCGTATAAGTTCATT

CATGTGTAGTTAGATCAACTTAAATGGTTACCGAGTCTCTGTTTATCTTTCAGGTTAGCATGCTAGTTCCATGGTCCTGGCACTTTACCTTGTGATTCCA

TGAGGTCTGCTATTTGTGTGATAGGATATGGCCGTTGGCCATTGGTCTAGCTGGATTCAGTTTTACAATTCCAAGTTTGCACTAACATGGGCTGTTTTGT

TGCCCAAACTCTCTTTCCATCCTCTACCTTTCCAGTCATTGTTGGCATCGTGAAAGTTAACTAATAATGTGAAGTTTTAACACCTACTTATAAAATTCTG

TTTTCTAGAAACAAGAGTCTTGGAGTGGTCTAATAATTAAGTGGCTTATAAGGTTCATATTATGGTTACAACCTCTCTATTTTTTTGCACTCAACAGTGA

TGAATATTTTTATGTTGAAACACTTGTAGCTGAAGGCGATCTAGAAGGAAGGATGAGTGAGTGAACAGGTCAAAGGTTTCTGTGCTCTAGGTACTAAGGC

GCTGTTCATAGTGAACTGATAAGTTTCTCACAGTTAGTTAGGGATATTAACATAAACTCCTTTTCACCTAAGGCAGGTATTTAGGTTGATAACATACTCA

TTACTATGCCTACTATAACTGATAAAGAATATTACACATAAGGCAGAGCCTGTCCTCAGTCAACACATTTTCTTTAAGAGACTCAATTTGATTCTCTTGA

AGAAACCTGGCAAGATTTTGTATTGGAATAGAAAAAAGTCTTGCACAACGTGTAAGGTGATAGATACTGTGAAACAAATGGAAAATATTGCCTCTTGCAT

CACATACCTCCTTTTCCAGAAACTTTATAGACTGCATTACAAAGGCCCTACAAGGAGAGAGTTCTCGAAGCAGTTCAAGTGGACAGCATTCACAGATTGT

TCATGTGTCCTCCACAGCTGGATGCGTGGCTTCTCCTAATCTCTTTGTAAACTTTGTCAGCCAATATTTTTTTAAACCTCTCTAGTTGTCTTATGGTTTT

GTTTTTTTTGGGTTTTTTTCATGCTGTTTTAGGGTTATTTCTGTGAATTTTTTGAATTATAGTTTTGTATTGCTAATGAGAGGGAAGAGAATTTTTACAA

GAGATATCCATGTAATTTATTTTTGAAAGCTTTGTTGAGTATCTAAGATTTCCTGCCACTTTGACAATCTCTGTATTTAGGAAAATTCATTACTTGAATA

CATGATGTAGAACATTGAGTTAGCAATGTACATGTACCGTACGATATGTAAGAGAACAATACACTGTGGCTAATTCTATACTAGATTTATTCTGTTGGTC

TGTACAACAGTTGGTCCTTTTGTCATAACTGTGTCTATTGAGGGAATCATTTCAGAATAGTGTATCAAAGCCAAGGTTTAGAATTTGCTACAGGAGTAGA

ATATATATTGAATTTTGTATGAATTATTTGTTTACATTACATAGCTGGGATATTTTGCCACTTTTAAAATGACTTTAGAAAAGGTCCTAGGAAACTTAAG

ATTAGTGATGTGTGTGGGTTTATGTGTAGAAATTCAAGGTACATTCTCATAGTCTGAATATAAGTAAAAGGCACAAAGGCTACAGCAGGATTCAAAGATC

TAACAAATGCCAATCCCACTTTAACTATGTTTCTGCATTTGAATGTACACAGCACTTTTCCTATATAGTTCTATACAAAGAAAACAGAACTAGGTATAAC

TGTGTTGTAGGATTGAAGAAATCATTATTTATGTCTGTCTTTGTTTCTTGTTATCCTACAAAGTTGATGTGTAAACATCAAGTTGATTTCATTGGTGCAT

GAGGAAAAGTGGATGTGATCTGTGAGGAACCAGAGTCCCATGGGAAGAGTTTAAGATGGCATTCAATATTCAGTGCTCAGGTATGTAGTAAGTACTGTAG

TCCTATGGGGCAAATGTGTAGATATTTTTAAACATTTTGCCGTAATTGCACAATTTTTGCATTTTTACCTGATGTCATTGTTTCTTGTAATAAAATCTTT

TCTGATTGAAAACTGCCAGTGTTGTAAACTGATCTCAAGAATGAATTTTGCAAAATTAAAATTTGGTGAAAATC
Translation
 - UNI35177 - MFTSGLTESTQKEVRIIGVEAESMDLVLNYAYTSRVILTEANVQALFTTASIFQIPSIQDQCAKYMISHLDPQNSIGVFIFADHYG

HQELGDRSKEYIRKKFLCVTKEQEFLQLTKDQLISILDSDDLNVDREEHVYESIIRWFEHEQSEREVHLPEIFAKCIRFPLMEDTFIEKIPPQFAQAIVK

SCGEPSNTSGCTQRLGMTASEMIICFDAAHKHSGKKQTVPCLDIVTGRVFKLCKPPNDLREVGILVSPDNDIYIAGGYRPSSSEVSIDHKAENDFWMYDH

STNRWLSKPSLLRARIGCKLVYCCGKMYAIGGRVYEGDGRNSLKSVECYDSRENCWMTVCAMPVAMEFHNAVEHKEKIYVLQG - UNI32201 - GEF

FLFYEPQKDYWGFLTPMTVPRIQGLAAVYKDSIYYIAGTCGNHQRVFTVEAYDIELNKWTRKKDFPCDQSINPYLKLVLFQNKLHLFVRATQVTVEEHIF

RTSRKNSLYQYDDIADQWMKVYETPDRLWDLGRHFECAVAKLYPQCLQKVL
Transcript ENSMUST00000032107
Sequence
GAAACGCAATGACATTTCCTCTTTAAATAACCGGAGCCGGGGCCCCTGTAGTAATGGCCGCGTCGGCAG - UNI35177 - ATTTAAGTAAGTCTTCC

CCAACACCGAATGGGATTCCATCTTCAGACACAGCCAACGATACCATGGATCCTTTCCATGCTTGCAGTATTCTTAAGCAACTCAAAACAATGTACGATG

AAGGACAGTTGACAGACATTGTAGTGGAAGTGGATCACGGGAAAACATTTTCCTGTCATAGAAACGTTCTTGCTGCAATCAGCCCCTACTTCAG ATCCA

TGTTCACTAGCGGCCTTACAGAAAGTACTCAGAAAGAAGTTCGAATCATTGGTGTTGAAGCTGAATCAATGGATTTAGTATTGAATTATGCCTATACCTC

TAGAGTTATTCTGACAGAGGCCAATGTTCAAGCCTTGTTCACTACAGCTAGCATCTTCCAAATTCCTTCCATACAAGACCAGTGTGCTAAGTATATGATT

AGTCATTTGGATCCACAGAATTCTATTGGAGTCTTTATCTTTGCTGATCATTATGGTCATCAGGAGCTTGGAGATCGATCAAAAGAATATATCCGTAAAA

AGTTTCTGTGTGTCACCAAAGAACAAGAGTTTCTCCAACTGACAAAAGACCAACTCATAAGCATACTAGACAGTGACGATTTAAATGTGGATCGGGAAGA

ACATGTTTATGAAAGCATTATAAGGTGGTTTGAACATGAGCAGAGTGAAAGAGAAGTACACCTTCCAGAGATTTTTGCCAAATGTATACGTTTTCCTCTA

ATGGAAGATACATTTATCGAGAAAATTCCTCCTCAGTTTGCACAGGCCATAGTCAAAAGTTGTGGAGAACCCTCCAACACCAGTGGCTGTACACAGAGGC

TTGGAATGACTGCTTCTGAAATGATCATATGTTTTGATGCTGCCCACAAACACTCAGGAAAGAAGCAAACAGTGCCTTGTCTAGATATCGTCACAGGAAG

AGTGTTTAAACTATGCAAACCACCAAATGACCTAAGAGAAGTTGGGATTCTTGTGTCACCAGATAATGACATATACATTGCAGGAGGCTACAGGCCAAGC

AGCAGTGAGGTGTCCATCGACCATAAAGCAGAAAATGATTTTTGGATGTATGACCATTCCACCAACAGATGGCTTTCCAAGCCGTCCTTGCTTCGGGCCA

GAATAGGCTGCAAGCTAGTATACTGCTGTGGTAAAATGTATGCAATTGGAGGGCGTGTTTACGAAGGTGATGGAAGAAACTCACTGAAGTCTGTGGAGTG

CTATGATAGCAGAGAGAATTGCTGGATGACTGTGTGTGCCATGCCAGTTGCAATGGAGTTTCATAATGCTGTGGAGCACAAAGAGAAAATCTACGTTTTA

CAGG - UNI32201 - GGGAATTTTTCCTCTTCTATGAGCCTCAAAAAGACTACTGGGGATTTTTAACCCCCATGACTGTGCCTCGAATCCAGGGCTT

AGCAGCTGTGTACAAAGACTCAATCTACTACATAGCTGGAACCTGTGGAAATCATCAGCGTGTGTTTACTGTTGAAGCCTATGATATAGAGCTAAATAAG

TGGACTCGTAAAAAGGACTTTCCGTGTGATCAGTCTATAAATCCATACCTGAAGCTAGTACTTTTCCAGAATAAACTCCATTTATTTGTGCGAGCTACTC

AAGTGACTGTTGAAGAACATATCTTCAGAACCAGCAGGAAAAATTCTCTTTACCAATACGATGACATTGCTGACCAGTGGATGAAAGTGTATGAGACCCC

AGATCGGCTGTGGGACCTTGGCCGCCATTTTGAGTGTGCGGTGGCTAAACTCTATCCTCAGTGTCTTCAGAAAGTTCTTTAAATAAGCAGCAGGCCAAAG

CACGCCCCTGGCATCTCATACTGAGGAAGCTGGCTTAGGAAATGCTGTCGCCATTGAAGAAAGCTAACAGAGTCTTGTATTCAGAAATGGGTGCTCATAA

AGACTGTGGTGTGGAGAGGGATTTGATTTTACCTTCATGATATTTTCAGTTCAGTCAGGAAAGGGAACAAAGTGCGGTTATCAGCATTTTTCCACCCCTG

GCATAAAAGTATCATCCTAGAGTTTTGTGATAAATAGTTGCTGAGAAACCAGGTGAATTCAAGACAACTATGCACTCTTGAAAAGCAGAATATTCCTGGG

TAGAGACATCCAAACTGGTTAACGTGACTTTCTTTTAACTACGGGTAACAATATGAGGCAATATCATTTATTTAGCTGTGATCTCTAACACAGAGAAGCA

CTAACCTAGATCCTCAGTCTTACTATTTATATCTATTTACATATATATTTTTGTGTACTGTTTTCAAGTGTACGAGATTTAAATGTGCTGTCAGCAGACG

GAAGGGAAACTCGGTTTTCAGAGCGAACTTTTAGTCCGATTGTTCCATGTAACTTTTAAGTTAAGCTGCAAGGTTAAAGTGGCAGTTTTCTGTCCATAAC

TTTTTCAAGTGCTAACACTGTCTCATTTTTTAAAATCCCAGAAAGGGCTCAGATTTGCAGGTGACTGGTGCTCGTATAAGTTCATTCATGTGTAGTTAGA

TCAACTTAAATGGTTACCGAGTCTCTGTTTATCTTTCAGGTTAGCATGCTAGTTCCATGGTCCTGGCACTTTACCTTGTGATTCCATGAGGTCTGCTATT

TGTGTGATAGGATATGGCCGTTGGCCATTGGTCTAGCTGGATTCAGTTTTACAATTCCAAGTTTGCACTAACATGGGCTGTTTTGTTGCCCAAACTCTCT

TTCCATCCTCTACCTTTCCAGTCATTGTTGGCATCGTGAAAGTTAACTAATAATGTGAAGTTTTAACACCTACTTATAAAATTCTGTTTTCTAGAAACAA

GAGTCTTGGAGTGGTCTAATAATTAAGTGGCTTATAAGGTTCATATTATGGTTACAACCTCTCTATTTTTTTGCACTCAACAGTGATGAATATTTTTATG

TTGAAACACTTGTAGCTGAAGGCGATCTAGAAGGAAGGATGAGTGAGTGAACAGGTCAAAGGTTTCTGTGCTCTAGGTACTAAGGCGCTGTTCATAGTGA

ACTGATAAGTTTCTCACAGTTAGTTAGGGATATTAACATAAACTCCTTTTCACCTAAGGCAGGTATTTAGGTTGATAACATACTCATTACTATGCCTACT

ATAACTGATAAAGAATATTACACATAAGGCAGAGCCTGTCCTCAGTCAACACATTTTCTTTAAGAGACTCAATTTGATTCTCTTGAAGAAACCTGGCAAG

ATTTTGTATTGGAATAGAAAAAAGTCTTGCACAACGTGTAAGGTGATAGATACTGTGAAACAAATGGAAAATATTGCCTCTTGCATCACATACCTCCTTT

TCCAGAAACTTTATAGACTGCATTACAAAGGCCCTACAAGGAGAGAGTTCTCGAAGCAGTTCAAGTGGACAGCATTCACAGATTGTTCATGTGTCCTCCA

CAGCTGGATGCGTGGCTTCTCCTAATCTCTTTGTAAACTTTGTCAGCCAATATTTTTTTAAACCTCTCTAGTTGTCTTATGGTTTTGTTTTTTTTGGGTT

TTTTTCATGCTGTTTTAGGGTTATTTCTGTGAATTTTTTGAATTATAGTTTTGTATTGCTAATGAGAGGGAAGAGAATTTTTACAAGAGATATCCATGTA

ATTTATTTTTGAAAGCTTTGTTGAGTATCTAAGATTTCCTGCCACTTTGACAATCTCTGTATTTAGGAAAATTCATTACTTGAATACATGATGTAGAACA

TTGAGTTAGCAATGTACATGTACCGTACGATATGTAAGAGAACAATACACTGTGGCTAATTCTATACTAGATTTATTCTGTTGGTCTGTACAACAGTTGG

TCCTTTTGTCATAACTGTGTCTATTGAGGGAATCATTTCAGAATAGTGTATCAAAGCCAAGGTTTAGAATTTGCTACAGGAGTAGAATATATATTGAATT

TTGTATGAATTATTTGTTTACATTACATAGCTGGGATATTTTGCCACTTTTAAAATGACTTTAGAAAAGGTCCTAGGAAACTTAAGATTAGTGATGTGTG

TGGGTTTATGTGTAGAAATTCAAGGTACATTCTCATAGTCTGAATATAAGTAAAAGGCACAAAGGCTACAGCAGGATTCAAAGATCTAACAAATGCCAAT

CCCACTTTAACTATGTTTCTGCATTTGAATGTACACAGCACTTTTCCTATATAGTTCTATACAAAGAAAACAGAACTAGGTATAACTGTGTTGTAGGATT

GAAGAAATCATTATTTATGTCTGTCTTTGTTTCTTGTTATCCTACAAAGTTGATGTGTAAACATCAAGTTGATTTCATTGGTGCATGAGGAAAAGTGGAT

GTGATCTGTGAGGAACCAGAGTCCCATGGGAAGAGTTTAAGATGGCATTCAATATTCAGTGCTCAGGTATGTAGTAAGTACTGTAGTCCTATGGGGCAAA

TGTGTAGATATTTTTAAACATTTTGCCGTAATTGCACAATTTTTGCATTTTTACCTGATGTCATTGTTTCTTGTAATAAAATCTTTTCTGATTG
Translation
MAASAD - UNI35177 - DLSKSSPTPNGIPSSDTANDTMDPFHACSILKQLKTMYDEGQLTDIVVEVDHGKTFSCHRNVLAAISPYFR RSMFTSGL

TESTQKEVRIIGVEAESMDLVLNYAYTSRVILTEANVQALFTTASIFQIPSIQDQCAKYMISHLDPQNSIGVFIFADHYGHQELGDRSKEYIRKKFLCVT

KEQEFLQLTKDQLISILDSDDLNVDREEHVYESIIRWFEHEQSEREVHLPEIFAKCIRFPLMEDTFIEKIPPQFAQAIVKSCGEPSNTSGCTQRLGMTAS

EMIICFDAAHKHSGKKQTVPCLDIVTGRVFKLCKPPNDLREVGILVSPDNDIYIAGGYRPSSSEVSIDHKAENDFWMYDHSTNRWLSKPSLLRARIGCKL

VYCCGKMYAIGGRVYEGDGRNSLKSVECYDSRENCWMTVCAMPVAMEFHNAVEHKEKIYVLQG - UNI32201 - GEFFLFYEPQKDYWGFLTPMTVP

RIQGLAAVYKDSIYYIAGTCGNHQRVFTVEAYDIELNKWTRKKDFPCDQSINPYLKLVLFQNKLHLFVRATQVTVEEHIFRTSRKNSLYQYDDIADQWMK

VYETPDRLWDLGRHFECAVAKLYPQCLQKVL

For any suggestions or comments, please send an email to unitrap@crg.es