Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030061 (Uba3)
Chromosomal location
Chr 6: 97133813 - 97155554 (-)
Description
ubiquitin-like modifier activating enzyme 3 Gene [Source:MGI Symbol;Acc:MGI:1341217]
RefSeq_peptide
NP_035796.2 NP_001104576.1 
UniGene
Mm.277626 Mm.431883 
MGI
MGI:1341217 
Uniprot/SWISSPROT
Q8C878 
Uniprot/SPTREMBL
Q3TG68 Q3TL72 Q66JT6 
Human Ortholog
ENSG00000144744 (UBA3)
Omim not available
UniTrap UNI25737
Vector Insertion
Chr 6: 97155342 - 97155526
Public Clones not available
Private Clones OST168478 (lexicon) OST96542 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13365
Vector Insertion
Chr 6: 97153589 - 97155299
Public Clones (sanger) CMHD-GT_329E2-3 (cmhd) IST10468E5 (tigm) IST12658E12 (tigm)
IST14646B12 (tigm)
Private Clones OST238315 (lexicon) OST197195 (lexicon) OST196716 (lexicon) OST126299 (lexicon)
OST110162 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36759
Vector Insertion
Chr 6: 97151910 - 97153589
Public Clones IST14504B1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36895
Vector Insertion
Chr 6: 97149232 - 97151992
Public Clones 5SE289E09 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21792
Vector Insertion
Chr 6: 97141243 - 97141519
Public Clones not available
Private Clones OST317847 (lexicon)
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3075
Vector Insertion
Chr 6: 97136711 - 97139522
Public Clones DC0250 (sanger) DC0242 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000089287
Sequence
GGAACAATATGGCGGATGGCGAGGAGCC - UNI25737 - GGAGAAGAAAAGAAGGAGAATAGAGGAGCTGCTGGCTGAGAA - UNI13365 - - 

UNI36759 - AATGGCTGTTGATGGTGGGTGTGGGGACACTGGAGACTGGGAAGGTCGCTGGAACCATGTAAAGAAGTTCCTCGAGCGGTCTGGACCCT

TCACACACCCCGATTTCGAACCAAGCACTGAA - UNI36759 - - UNI36895 - TCACTCCAGTTCTTGTTAGATACATGTAAAGTTCTAGTCAT

TGGAGCTGGTGGCTTAGGATGTGAGCTTCTGAAAAATCTG - UNI36759 - - UNI36895 - GCATTATCTGGTTTTAGACAGATTCATGTTATA

GACATGGACACTATAGATGTTTCCAATTTAAATAGACAGTTTTTATTTAG - UNI36895 - GCCTAAAGATGTCGGAAGACCCAAGGCTGAAGTTGC

TGCAGAATTCCTAAATGACAGAGTTCCTAACTGCAACGTGGTACC ACATTTCAACAAGATACAAGATTTTAACGACACTTTCTACCGAC AATTTCATA

TCATTGTATGTGGCCTGGACTCTATCATAGCGAGAAGATGGATCAATGGAATGCTG - UNI21792 - ATATCTCTTCTAAATTATGAAGATGGTGTG

TTGGATCCAAGCTCCATTGTACCTTTGATAGATGGGGGGACAGAAGGCTTTAAAGGGAATGCCCGAGTGATTTTGCCTGGAATGACCGCTTGTATTGAGT

GCACTCTGGAACTTTACCCACCACAG GTCAATTTCCCCATGTGTACCATTGCATCTATGCCCAGGCTCCCAGAACACTGTATCGAGTATGTGAGGATGT

TGCAATGGCCTAAAGAGCAGCCTTTTGGAG ATGGGGTTCCATTAGATGGAGATGACCCTGAACATATTCAGTGGATTTTCCAAAAGTCCATAGAGAGAG

CATCACAATATAATATTAGAGGCGTTACCTACAGACTCACTCAAG - UNI3075 - GGGTGGTAAAACGAATCATTCCTGCAGTAGCTTCTACAAATG

CAGTCATTGCAG CTGTGTGTGCCACTGAGGTTTTCAAGATAGCTACAAG TGCGTACATTCCCCTTAATAACTACCTGGTATTCAATGATGTAGATGGG

CTGTACACTTACACGTTTGAAGCAGAGAGAAAG GAAAACTGTCCAGCATGTAGCCAACTTCCTCAAAACATTCAGTTTTCCCCATCAGCTAAACTACAG

GAGGTCTTAGACTACCTAACCAACAGTGCTTCTCT GCAAATGAAGTCTCCGGCTATCACAGCCACATTAGAGGGGAAGAACAGGACACTTTACTTACAG

 TCAGTAACGTCTATTGAAGAACGAACCAGGCCCAATCTTTCCAAAACATTAAAAG AACTGGGACTAGTTGATGGACAAGAACTGGCTGTTGCTGATGT

CACTACACCACAGACTGTACTATTCAAACTTCATTTTACTTAAGGAAAATAAATCTGCACATAATAGAAAATTCATAGAAATAATATACTTTATAAATGA

TATGAAATTGAAGAGCCTGGAAGATGAGGCAGAGGGGAACATCCAAGAAAGGAAATTTAATTGGTGTCATTTTTAGCATTAGTGTGGCTAGAATTTGACT

TTTATATATATACATATATATAAAAAAGGACTGACTCTTTTTTAACTTTATAAGTTTCTCTTGAAGACTGAACTTTGGGGTTGGGCTAGCAAGCATTTTC

ATTTTATTACTATGGAAAGCTATGCCTTCAGGAGAGATTATGAACAAGTGTGTTGCTTCTTTAAAGCAGGACAAACACTGTCTTGTGTGTGAGTTTGTTG

TGGTCAAAGAGCATATTCCTCAGCGTGTATCTGAAATCCACATGTGTAGAAATGTCTCCTGGGATGGAAATGAGGAGCTATGTCTGAAGAATAGTAAATA

TTCACAGCCTGACATCTAGAGTATATCAAACATAGGCAGTGTCTTCATTGCTACTCATATAATTGTGACTATCCATGTGTGTATTAATTATTGCAGAATT

TAACTTGTCCATGATAATTTGTAAACAGTATTATAGATTCATACCTGTGCATGAAAATACAAAATATTTTCATGTATTTGTTTGCAATGCCACAGAGACC

AGTATGCACAAATTTAAACCAAGACATGGCTGTTCAAAGAAAATTAATGTTTAAACAGTTATCATTGATGCTTTTGCACTATTTATTAATAAAATTGTAC

ATTGTCTTTTTATTGGAAAACTTAAAGTATATCAATAATAGTAAATAACTTTATAGTGATGTAGAAATAATTTTTAAATGTTTACCAGTTATTATTTCCA

GACTTTTATTGCGCCTGAGTTAAATTTTTAAAATTTTATTATAGTGATTTCCATAGTACAGACTAGGTTCACTCATTCTAACTAGTAAATGAAATGGAAT

GACT
Translation
MADGEEP - UNI25737 - PEKKRRRIEELLAEK - UNI13365 - - UNI36759 - KMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFE

PSTE - UNI36759 - - UNI36895 - SLQFLLDTCKVLVIGAGGLGCELLKNL - UNI36759 - - UNI36895 - ALSGFRQIHVIDMDT

IDVSNLNRQFLFR - UNI36895 - RPKDVGRPKAEVAAEFLNDRVPNCNVVP PHFNKIQDFNDTFYRQ QFHIIVCGLDSIIARRWINGML - UN

I21792 - ISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQ VNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGD DG

VPLDGDDPEHIQWIFQKSIERASQYNIRGVTYRLTQG - UNI3075 - GVVKRIIPAVASTNAVIAA AVCATEVFKIATS SAYIPLNNYLVFNDVD

GLYTYTFEAERK ENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASL LQMKSPAITATLEGKNRTLYLQ SVTSIEERTRPNLSKTLKE ELGLVDGQE

LAVADVTTPQTVLFKLHFT
Transcript ENSMUST00000032142
Sequence
GGAACAATATGGCGGATGGCGAGGAGCC - UNI25737 - GGAGAAGAAAAGAAGGAGAATAGAGGAGCTGCTGGCTGAGAA - UNI13365 - - 

UNI36759 - AATGGCTGTTGATGGTGGGTGTGGGGACACTGGAGACTGGGAAGGTCGCTGGAACCATGTAAAGAAGTTCCTCGAGCGGTCTGGACCCT

TCACACACCCCGATTTCGAACCAAGCACTGAA - UNI36759 - - UNI36895 - GCATTATCTGGTTTTAGACAGATTCATGTTATAGACATGGA

CACTATAGATGTTTCCAATTTAAATAGACAGTTTTTATTTAG - UNI36895 - GCCTAAAGATGTCGGAAGACCCAAGGCTGAAGTTGCTGCAGAAT

TCCTAAATGACAGAGTTCCTAACTGCAACGTGGTACC ACATTTCAACAAGATACAAGATTTTAACGACACTTTCTACCGAC AATTTCATATCATTGTA

TGTGGCCTGGACTCTATCATAGCGAGAAGATGGATCAATGGAATGCTG - UNI21792 - ATATCTCTTCTAAATTATGAAGATGGTGTGTTGGATCC

AAGCTCCATTGTACCTTTGATAGATGGGGGGACAGAAGGCTTTAAAGGGAATGCCCGAGTGATTTTGCCTGGAATGACCGCTTGTATTGAGTGCACTCTG

GAACTTTACCCACCACAG GTCAATTTCCCCATGTGTACCATTGCATCTATGCCCAGGCTCCCAGAACACTGTATCGAGTATGTGAGGATGTTGCAATGG

CCTAAAGAGCAGCCTTTTGGAG ATGGGGTTCCATTAGATGGAGATGACCCTGAACATATTCAGTGGATTTTCCAAAAGTCCATAGAGAGAGCATCACAA

TATAATATTAGAGGCGTTACCTACAGACTCACTCAAG - UNI3075 - GGGTGGTAAAACGAATCATTCCTGCAGTAGCTTCTACAAATGCAGTCATT

GCAG CTGTGTGTGCCACTGAGGTTTTCAAGATAGCTACAAG TGCGTACATTCCCCTTAATAACTACCTGGTATTCAATGATGTAGATGGGCTGTACAC

TTACACGTTTGAAGCAGAGAGAAAG GAAAACTGTCCAGCATGTAGCCAACTTCCTCAAAACATTCAGTTTTCCCCATCAGCTAAACTACAGGAGGTCTT

AGACTACCTAACCAACAGTGCTTCTCT GCAAATGAAGTCTCCGGCTATCACAGCCACATTAGAGGGGAAGAACAGGACACTTTACTTACAG TCAGTAA

CGTCTATTGAAGAACGAACCAGGCCCAATCTTTCCAAAACATTAAAAG AACTGGGACTAGTTGATGGACAAGAACTGGCTGTTGCTGATGTCACTACAC

CACAGACTGTACTATTCAAACTTCATTTTACTTAAGGAAAATAAATCTGCACATAATAGAAAATTCATAGAAATAATATACTTTATAAATGATATGAAAT

TGAAGAGCCTGGAAGATGAGGCAGAGGGGAACATCCAAGAAAGGAAATTTAATTGGTGTCATTTTTAGCATTAGTGTGGCTAGAATTTGACTTTTATATA

TATACATATATATAAAAAAGGACTGACTCTTTTTTAACTTTATAAGTTTCTCTTGAAGACTGAACTTTGGGGTTGGGCTAGCAAGCATTTTCATTTTATT

ACTATGGAAAGCTATGCCTTCAGGAGAGATTATGAACAAGTGTGTTGCTTCTTTAAAGCAGGACAAACACTGTCTTGTGTGTGAGTTTGTTGTGGTCAAA

GAGCATATTCCTCAGCGTGTATCTGAAATCCACATGTGTAGAAATGTCTCCTGGGATGGAAATGAGGAGCTATGTCTGAAGAATAGTAAATATTCACAGC

CTGACATCTAGAGTATATCAAACATAGGCAGTGTCTTCATTGCTACTCATATAATTGTGACTATCCATGTGTGTATTAATTATTGCAGAATTTAACTTGT

CCATGATAATTTGTAAACAGTATTATAGATTCATACCTGTGCATGAAAATACAAAATATTTTCATGTATTTGTTTGCAATGCCACAGAGACCAGTATGCA

CAAATTTAAACCAAGACATGGCTGTTCAAAGAAAATTAATGTTTAAACAGTTATCATTGATGCTTTTGCACTATTTATTAATAAAATTGTACATTGTCTT

TTTATTGGAAAACTTAAAGTATATCAATAATAGTAAATAACTTTATAGTGATGTAGAAATAATTTTTAAATGTTTACCAGTTATTATTTCCAGACTTTTA

TTGCGCCTGAGTTAAATTTTTAAAATTTTATTATAGTGATTTCCATAGTACAGACTAGGTTCACTCATTCTAACTAGTAAATGAAATGGAATGACT
Translation
NNMADGEEP - UNI25737 - PEKKRRRIEELLAEK - UNI13365 - - UNI36759 - KMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPD

FEPSTE - UNI36759 - - UNI36895 - ALSGFRQIHVIDMDTIDVSNLNRQFLFR - UNI36895 - RPKDVGRPKAEVAAEFLNDRVPNCN

VVP PHFNKIQDFNDTFYRQ QFHIIVCGLDSIIARRWINGML - UNI21792 - ISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIE

CTLELYPPQ VNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGD DGVPLDGDDPEHIQWIFQKSIERASQYNIRGVTYRLTQG - UNI3075 - GV

VKRIIPAVASTNAVIAA AVCATEVFKIATS SAYIPLNNYLVFNDVDGLYTYTFEAERK ENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASL LQMK

SPAITATLEGKNRTLYLQ SVTSIEERTRPNLSKTLKE ELGLVDGQELAVADVTTPQTVLFKLHFT

For any suggestions or comments, please send an email to unitrap@crg.es