Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030084 (Plxna1)
Chromosomal location
Chr 6: 89268851 - 89312592 (-)
Description
plexin A1 Gene [Source:MGI Symbol;Acc:MGI:107685]
RefSeq_dna
NM_008881 
RefSeq_peptide
NP_032907.1 
MGI
MGI:107685 
Uniprot/SWISSPROT
P70206 
Uniprot/SPTREMBL
B2RQP7 Q3U3W7 
Human Ortholog
ENSG00000114554 (PLXNA1)
Omim not available
UniTrap UNI8915
Vector Insertion
Chr 6: 89305033 - 89306451
Public Clones RST540 (baygenomics) G073E10 (ggtc) P076B09 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6966
Vector Insertion
Chr 6: 89294104 - 89304849
Public Clones KST269 (baygenomics) KST290 (baygenomics) P075E06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1164
Vector Insertion
Chr 6: 89274681 - 89279377
Public Clones AZ0182 (sanger) IST12935H3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000049845
Sequence
AGGCCGGTCCGCAGCCGCGCGGAGCTCAGCGCCCCATTCATGCTGGGCAGCGGCGACGCAGCCACGCAGCGGAGCGGAGCCCGGGCGCGGCGGCCTCGGC

CTGGGCGGCCTGCGCGGCGTGGGCGGCCCCGCAGAGGGGCGAGCGGCGGGGCGCAACGATGGCCAGCGGCGGGACGCGCCCGGGGTTGGCGG GGCCAAG

AAACCCAATCCCATGATGCTCGCCCCTATAGGACCTGAATACTTTGGCTTGAGGCCCCAGCCCACCATGCCACTGCCACCTCTGAGCTCTCGGACACTGC

TGCTGCTGCTCTTGCTGCTGCTGAGGGGTGTGTGGATAGCCATCAGCTCGCCCCCAGCTGGTTTGGGTCCACAACCTGCCTTCCGCACCTTTGTGGCCAG

TGACTGGGGCCTCACTCACCTGGTGGTTCACGAACAGACAGGAGAGGTATATGTTGGCGCTGTGAACCGTATTTACAAGCTGTCGGGGAACCTAACCCTG

CTTCGGGCCCATGTGACAGGCCCTGTAGAAGACAATGAGAAATGCTACCCACCCCCCAGTGTACAGTCCTGCCCACATGGTCTGGGCAGCACAGACAACG

TCAACAAGCTTCTACTGCTGGACTATGCAGCCAACCGCCTGTTGGCCTGTGGCAGTGCCTCACAGGGCATCTGCCAGTTCCTGAGGTTGGACGATCTCTT

CAAGCTGGGCGAGCCGCACCACCGCAAGGAACACTACCTGTCCAGTGTTCGAGAGGCTGGCAGCATGGCGGGAGTGCTCATTGCTGGGCCACCCGGCCAG

GGCCAGGCCAAGCTCTTCGTGGGCACACCCATCGATGGCAAATCAGAATACTTCCCCACTCTGTCCAGTCGCCGGCTCATGGCCAACGAGGAAGATGCTG

ACATGTTTGGCTTTGTGTACCAGGATGAGTTTGTGTCATCTCAGCTCAAGATCCCTTCAGACACATTGTCCAAGTTCCCAGCCTTTGACATCTACTATGT

GTACAGTTTCCGCAGCGAGCAGTTCGTATACTACCTCACCCTGCAGCTAGACACGCAGCTTACCTCGCCCGACGCCGCTGGCGAGCACTTCTTCACCTCC

AAGATTGTGCGGCTGTGCGTGAATGACCCCAAGTTCTACTCTTACGTGGAGTTCCCCATTGGCTGCGAGCAGGCTGGCGTGGAGTATCGGCTGGTGCAGG

ACGCCTACCTGAGCCGGCCGGGACAGGCCCTGGCCAAACAGCTGGGCCTGGCTGAGGATGAGGAGGTGTTGTTCACTGTGTTCGCACAGGGCCAGAAGAA

CCGCGTGAAGCCACCCAAGGAGTCGGCGCTGTGCCTGTTCACACTGAGGGCCATCAAGGAGAAAATCAAGGAGCGCATCCAATCCTGCTACCGTGGAGAA

GGAAAGCTCTCCCTGCCTTGGCTGCTCAACAAGGAGCTGGGCTGCATCAACTCG - UNI8915 - CCCCTGCAGATTGATGACGACTTCTGCGGGCAG

GATTTCAACCAGCCACTGGGTGGCACGGTCACCATCGAGGGCACACCCCTTTTTGTCGACAAGGAAGATGGCCTGACTGCTGTGGCTGCCTATGACTACC

AAGGCCGCACCGTGGTTTTTGCTGGCACTCGCAGCGGCCGCATCCGCAAG - UNI6966 - ATTCTGGTGGACCTTGCAAACCCCAGCGGCAGGCCGG

CCCTGGCTTATGAAAGTGTGGTGGCTCAGGAGGGCAACCCTATCCTGCGTGACCTGGTCCTCAGCCCCAACCGCCAGTACCTCTATGCTATGACGGAGAA

GCAG GTGACGCAGGTGCCTGTGGAAAGCTGTGTCCAGTATACTTCCTGTGAGCTGTGCCTGGGGTCTCGGGACCCCCACTGTGGCTGGTGTGTCCTGCA

CAGCAT CTGCTCTAGGCAGGATGCCTGTGAGCGGGCAGAAGAGCCCCAGCGTTTTGCCTCTGACCTGCTGCAGTGTGTGCAGTTAACTGTCCAGCCGCG

CAATGTGTCAGTCACCATGTCCCAGGTGCCG CTCGTGCTGCAGGCTTGGAATGTGCCTGACCTCTCAGCTGGTGTCAACTGCTCCTTTGAGGACTTCAC

GGAGACTGAGAGCATCCTGGAAGATGGCCGCATCCATTGCCACTCACCTTCTGCCCGGGAAGTGGCGCCCATCACACAGGGTCAGG GAGACCAGCGGGT

GGTGAAGCTCTACCTCAAGTCCAAGGAGACAGGGAAGAAGTTTGCATCTGTGGACTTTGTCTTCTATAACTGCAGTGTTCACCAGTC CTGCCTGGCATG

TGTCAACGGCTCCTTCCCCTGCCATTGGTGCAAATACCGCCATGTTTGCACCAACAATGCGGCTGACTGCGCCTTTCTGGAAGGCCGAGTCAACATGTCT

GAG GACTGCCCACAGATCCTGCCTTCTACCCACATCTATGTGCCAGTGGGTGTGGTGAAGCCCATCACCCTGGCTGCACGGAACCTGCCGCAGCCACAG

TCGGGTCAGCGAGGGTACGAGTGCCTTTTCCACATCCCAGGCAGCCCGGCCCGAGTCACTGCACTGCGCTTCAACAGCTCCAGCCTGCAGTGCCAGAACT

CCTCG TACTCCTATGAGGGGAATGATGTCAGCGATCTGCCTGTGAACCTGTCGGTTGTGTGGAATGGCAACTTTGTCATTGACAACCCCCAGAACATCC

AGG CCCACCTCTACAAGTGCCCAGCCTTGCGCCAGAGTTGTGGCCTCTGCCTCAAGGCAGACCCACGCTTTGAGTGCGGCTGGTGCGTAGCTGAGCGCC

GCTGTTCCCTTCGTCACCACTGCCCAGCTGACTCACCAGCCTCCTGGATGCATGCCCACCATGGCAGCAGCCGCTGCACAGACCCCAAGATTCTCAAG C

TGTCCCCAGAGACAGGCCCTCGGCAGGGAGGGACTCGACTAACCATCACCGGTGAGAATCTGGGCCTCCGGTTTGAGGATGTGCGGCTAGGCGTGCACGT

GGGCAAGGTGCTTTGCAGCCCTGTGGAGAGCGAGTACATCAGCGCAGAACA GATTGTCTGCGAGATTGGAGATGCCAGCACGCTGCGGGCCCATGATGC

CCTGGTGGAGGTGTGTGTGCGGGACTGCTCCCTCCACTACCGAGCGCTGTCCCCTAAACGCTTCACTTTTGTG ACACCGACCTTCTACCGTGTGAGCCC

CTCCCGTGGGCCTCTGTCTGGAGGTACCTGGATTGGCATCGAAGGGAGCCATCTGAATGCTGGCAGTGATGTAGCTGTGTCCATTGGCGGTCGGCCCTGC

TCCTTCTCCTG GAGAAACTCACGAGAGATCCGCTGCCTGACACCGCCCGGGCACACTCCTGGCAGCGCCCCTATTGTTATCAACATCAATCGTGCCCAG

CTCTCCAACCCCGAGGTGAAGTACAACTATACTGAAGACCCTACTATCCTGAGGATCGACCCTGAGTGGAGCATCAATAG TGGTGGGACCCTCCTAACA

GTCACGGGCACCAACCTGGCCACTGTCCGTGAACCTCGAATCCGCGCCAAGTATGGAGGCATTGAGAGGGAAAAT AGCTGCATGGTGTACAATGACACC

ACCATGGTGTGCCGGGCGCCGTCTATAGACAACCCAAAGCGCAGCCCGCCAGAACTGGGAGAGCGGCCAGATGAGATTGGTTTCATCATGGACAATGTGC

GCACGCTGCTGGTACTCAACAGCTCCTCCTTCCTCTACTACCCGGACCCTGTACTGGAGCCACTTAGCCCTACTGGGCTCTTGGAGCTGAAGCCCAGCTC

CCCGCTCATCCTCAAG GGGCGGAATCTCCTGCCACCTGCTCCTGGCAATTCCCGGCTCAACTACACGGTGCTCATCGGCTCCACACCTTGTATCCTCAC

CGTGTCTGAGACACAGCTGCTGTGTGAAGCACCCAACCTCACGGGGCAGCACAAAGTCACG GTGCGGGCCGGGGGCTTCGAGTTCTCACCTGGGATGCT

GCAGGTGTATTCGGACAGCCTGCTGACACTGCCGGCCATTGTGGGTATCGGTGGTGGGGGTGGCCTCTTGCTGCTGGTCATCGTGGCTGTGCTCATCGCC

TACAAACGCAAATCCCGGGATGCTGACCGTACCCTCAAGCGGCTGCAGCTCCAGATGGACAACCTGGAGTCACGGGTGGCCCTCGAGTGCAAGGAAG CT

TTTGCAGAGCTACAGACGGACATCCATGAGCTGACCAGTGACCTGGATGGTGCTGGCATCCCCTTCCTTGACTACCGCACATATGCCATGCGAGTGCTGT

TTCCTGGGATTGAGGACCATCCTGTACTGAAGGAGATGGAG GTGCAGGCCAATGTGGAGAAGTCGCTGACACTGTTCGGACAGCTGTTGACCAAGAAGC

ATTTCCTGCTAACCTTCATCCGCACACTAGAGGCCCAGCGTAGCTTCTCCATGCGTGACCGTGGGAACGTGGCCTCACTCATCATGACAGCCCTGCAGGG

TGAGATGGAGTATGCCACAGGAGTGCTAAAGCAGTTGCTGTCTGACCTCATCGAGAAAAACCTAGAAAGCAAGAACCACCCCAAGCTCCTGTTACGGAG 

GACCGAATCAGTGGCAGAGAAGATGTTGACCAACTGGTTCACCTTCCTTTTGTATAAGTTCCTCAAG - UNI1164 - GAGTGTGCTGGGGAGCCGCT

CTTTATGCTGTACTGTGCCATCAAGCAGCAGATGGAGAAGGGCCCTATTGACGCCATCACAGGGGAGGCCCGCTACTCTCTGAGCGAAGACAAGCTCATT

CGGCAGCAGATTGACTACAAGACCCTG ACCCTGAACTGCGTGAACCCTGAACATGAGAATGCGCCCGAGGTTCCTGTGAAGGGGCTGAACTGTGACACC

GTGACCCAGGTCAAGGAGAAGCTCCTGGATGCTGTGTACAAGGGTGTGCCTTACTCACAGCGGCCGAAGGCCGGGGACATGGACCTGG AGTGGCGCCAG

GGTCGCATGGCACGCATCATCCTTCAGGACGAGGACGTCACCACTAAAATTGACAATGACTGGAAGAGGCTGAACACACTAGCTCACTATCAG GTGACG

GATGGGTCATCGGTGGCACTAGTACCCAAGCAGACATCGGCCTACAACATCTCCAACTCCTCTACCTTCACTAAGTCCCTCAGCAGATACG AGAGCATG

CTGCGTACAGCCAGTAGCCCCGACAGCCTACGCTCACGAACACCCATGATCACGCCAGACCTGGAAAGTGGAACAAAACTGTGGCACCTGGTGAAGAACC

ACGACCACCTGGACCAACGTGAAGGCGACCGTGGCAGCAAGATGGTCTCTGAGATCTACCTAACCAGGCTGCTGGCCACCAAG GGAACACTACAAAAGT

TCGTGGATGACCTGTTCGAGACCATCTTCAGCACGGCGCACCGTGGCTCAGCCCTACCTCTGGCCATCAAGTACATGTTTGACTTCTTAGATGAGCAGGC

CGACAAGCATCAGATCCACGACTCAGATGTGCGCCATACCTGGAAGAGCAATTG CCTGCCTCTGCGCTTCTGGGTGAATGTGATTAAGAACCCTCAGTT

CGTGTTCGACATCCACAAGAACAGCATAACAGATGCCTGCCTCTCAGTGGTAGCGCAGACCTTCATGGACTCCTGCTCTACATCAGAGCACAAGCTGGGC

AAAGACTCACCCTCCAACAAGTTGCTCTATGCCAAGGACATCCCCAACTACAAGAGCTGGGTTGAAAG GTACTATGCTGACATTGCCAAGATGCCTGCA

ATCAGTGACCAAGACATGAGCGCCTACCTGGCAGAGCAGTCCCGGCTGCATCTCAGCCAGTTCAACAGCATGAGTGCCCTGCACGAGATCTACTCCTACA

TCGCCAAGTACAAGGACGAG ATTCTGGTGGCTCTGGAGAAAGATGAACAGGCTCGAAGGCAGCGGCTTCGAAGCAAACTGGAGCAGGTGGTGGACACAA

TGGCCCTGAGCAGCTGAGCCCTGGAAGTGCCCACCCAGCAGGAGGCAGAGCAGGAGGGCAGCAGAGGACCCAGGAGACAGCCCTTGGCCCACCTGTACCA

AGTCCAGGTGTGGGGGCTGTGGTTGGGTCCTGGCCCTCGCCTTCCTCTCCCTGCCATGCAGGGCCAATTCTTATCGCTGTGGATGTAAGGGTTCCTGCTG

AGCCGCCTCTGTGCCTGGGGCTTGCTGCCGTGGGGCAAGGATAGCACAGCGTGGCTGGTTCTGCCCAGGGATATTTGCTGCTTGGCAAGAGCTGCTAGTG

GTTTTCCTGAGAGAGAGGTGGCCTCTGAGGGGCCGAGATAGAAGGCCAGGCCCTCCAGAAGGAGGGCAGCAGGACAAGGGGCTGGACCAATTCACATTTC

TTGGCTTCTTCAGCTGCTACCAGCAGGCAGAGTCTGAGGGAGAGGTGAGATACCCAAGGCTAGGCCACATAAGTCACAGCCTGGGGCTGTCCCACCAGCC

TCTACTCTAGCACCCTGTGCTTGCCACCACCCTCAG
Translation
 MPLPPLSSRTLLLLLLLLLRGVWIAISSPPAGLGPQPAFRTFVASDWGLTHLVVHEQTGEVYVGAVNRIYKLSGNLTLLRAHVTGPVEDNEKCYPPPSV

QSCPHGLGSTDNVNKLLLLDYAANRLLACGSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVREAGSMAGVLIAGPPGQGQAKLFVGTPIDGKSEYFPTL

SSRRLMANEEDADMFGFVYQDEFVSSQLKIPSDTLSKFPAFDIYYVYSFRSEQFVYYLTLQLDTQLTSPDAAGEHFFTSKIVRLCVNDPKFYSYVEFPIG

CEQAGVEYRLVQDAYLSRPGQALAKQLGLAEDEEVLFTVFAQGQKNRVKPPKESALCLFTLRAIKEKIKERIQSCYRGEGKLSLPWLLNKELGCINS - 

UNI8915 - PLQIDDDFCGQDFNQPLGGTVTIEGTPLFVDKEDGLTAVAAYDYQGRTVVFAGTRSGRIRK - UNI6966 - ILVDLANPSGRPALAY

ESVVAQEGNPILRDLVLSPNRQYLYAMTEKQ VTQVPVESCVQYTSCELCLGSRDPHCGWCVLHSI ICSRQDACERAEEPQRFASDLLQCVQLTVQPRN

VSVTMSQVP LVLQAWNVPDLSAGVNCSFEDFTETESILEDGRIHCHSPSAREVAPITQGQG GDQRVVKLYLKSKETGKKFASVDFVFYNCSVHQS SC

LACVNGSFPCHWCKYRHVCTNNAADCAFLEGRVNMSE DCPQILPSTHIYVPVGVVKPITLAARNLPQPQSGQRGYECLFHIPGSPARVTALRFNSSSLQ

CQNSS YSYEGNDVSDLPVNLSVVWNGNFVIDNPQNIQA AHLYKCPALRQSCGLCLKADPRFECGWCVAERRCSLRHHCPADSPASWMHAHHGSSRCTD

PKILK LSPETGPRQGGTRLTITGENLGLRFEDVRLGVHVGKVLCSPVESEYISAEQ QIVCEIGDASTLRAHDALVEVCVRDCSLHYRALSPKRFTFV 

TPTFYRVSPSRGPLSGGTWIGIEGSHLNAGSDVAVSIGGRPCSFSW WRNSREIRCLTPPGHTPGSAPIVININRAQLSNPEVKYNYTEDPTILRIDPEW

SINS SGGTLLTVTGTNLATVREPRIRAKYGGIEREN SCMVYNDTTMVCRAPSIDNPKRSPPELGERPDEIGFIMDNVRTLLVLNSSSFLYYPDPVLEP

LSPTGLLELKPSSPLILK GRNLLPPAPGNSRLNYTVLIGSTPCILTVSETQLLCEAPNLTGQHKVT VRAGGFEFSPGMLQVYSDSLLTLPAIVGIGGG

GGLLLLVIVAVLIAYKRKSRDADRTLKRLQLQMDNLESRVALECKEA AFAELQTDIHELTSDLDGAGIPFLDYRTYAMRVLFPGIEDHPVLKEME VQA

NVEKSLTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRR RTESVAEKMLTNWFTF

LLYKFLK - UNI1164 - ECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTL TLNCVNPEHENAPEVPVKGLNCDTVTQVKE

KLLDAVYKGVPYSQRPKAGDMDLE EWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQ VTDGSSVALVPKQTSAYNISNSSTFTKSLSRYE ESMLR

TASSPDSLRSRTPMITPDLESGTKLWHLVKNHDHLDQREGDRGSKMVSEIYLTRLLATK GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQAD

KHQIHDSDVRHTWKSNC CLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLGKDSPSNKLLYAKDIPNYKSWVER RYYADIAKM

PAISDQDMSAYLAEQSRLHLSQFNSMSALHEIYSYIAKYKDE ILVALEKDEQARRQRLRSKLEQVVDTMALSS

For any suggestions or comments, please send an email to unitrap@crg.es