Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030105 (Arl8b)
Chromosomal location
Chr 6: 108733076 - 108773542 (+)
Description
ADP-ribosylation factor-like 8B Gene [Source:MGI Symbol;Acc:MGI:1914416]
RefSeq_dna
NM_026011 
RefSeq_peptide
NP_080287.1 
UniGene
Mm.271178 
MGI
MGI:1914416 
Uniprot/SWISSPROT
Q9CQW2 
Uniprot/SPTREMBL
Q9DAB3 
Human Ortholog
ENSG00000134108 (ARL8B)
Omim not available
UniTrap UNI4725
Vector Insertion
Chr 6: 108733372 - 108763620
Public Clones XR1072 (sanger) (sanger) AK0793 (sanger) RRP119 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28199
Vector Insertion
Chr 6: 108765052 - 108765251
Public Clones not available
Private Clones OST37466 (lexicon)
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9956
Vector Insertion
Chr 6: 108768608 - 108771496
Public Clones XC416 (baygenomics) W058B03 (ggtc)
Private Clones OST454476 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000032196
Sequence
ATGACCCGCTGGGCTTCCTGGCTCCGGCCGTCGCTGCCGCCAGCCTCTGTCTGCCCGCGTCGCGCCAGGGGCCCCGCCGAAGAGCCGTTGGCGGGTTCGG

GGCCGATACCCGCTCGTGGGAAAGAGTGTCCGCTGTCGTCCGCGCCCGTCCACGCTCGCAGCCGGCCGCCGCCATGCTGGCGCTCATCTCCCGCCTGCTG

GACTGGTTCCGTTCGCTCTTCTGGAAGGAGGAGATGGAACTGACGCTCGTGGGGCTGCAGTACTCCGGCAAGACCACCTTCGTCAATGTCATCGCG - U

NI4725 - TCCGGTCAATTCAGTGAAGATATGATACCCACAGTGGGCTTCAACATGAGGAAAGTAACTAAAGGCAACGTCACAATAAAG ATCTGGGAC

ATAGGCGGACAGCCCCGGTTCCGGAGCATGTGGGAGCGGTACTGCCGAGGAGTCAATGCAATTGT - UNI28199 - TTACATGATAGATGCTGCAGA

TCGAGAAAAGATAGAAGCCTCTCGAAATGAACTGCATAATCTTCTAGATAAACCACAGTTACAAGGGATTCCA GTACTAGTACTTGGAAACAAGAGAGA

TCTTCCAAATGCCTTGGATGAGAAACAGCTAATTGAGAAAAT GAACCTGTCTGCTATTCAGGATAGAGAAATTTGCTGCTATTCAATTTCTTGCAAAGA

AAAGGATAATATAG - UNI9956 - ATATCACACTTCAGTGGCTTATTCAACACTCAAAATCCCGGAGAAGCTGAGACCTCTTCTTCGTCTTCCAGTC

CCCTTGGCTCTAACCTTAGAACTCCTGTCGTTCCTCTGAAGTACTTCCCAGGACATGGTCCTTCCTAAACCCAAGAAATTGCCTTTTTCAGAGTTTATTT

CTCATGTGCACTGCTGAAGATGTGTATTCCTATCCTTCATAGCAAATCAGCTGGAGTTGTCATGATAAAAGTCAGCACACACTAAAAGGCTTCATATACG

TGTCTAGTGTGTTGAGGCCTCTTTCCTTTCTATTTTAAACACCCACATTTTTGACCATCTTAATTAAGAAAATTGCATATTACCATTCTGGTCTTTCTGG

GCCAGATTTTTGTATTGGTTTTCAGTAAATGTCTACCTATTTCATTACAGAGTCCAGTAGCTTCTACTACTGGTATGGACTTGATGCAGCATGGAATTTC

TAGTGCCACCCACAGTATTTAGAAAACCTTTAAGCCTGACTGATGTGGGATACGGACATACTGTTTATCCCATCTCACACATGCATGTGAAATGTAGACT

TACACTGTAGGAATAATTGGTCTGTCAGAGTTAACAGAGGCACCAGGTCAGAATAGTAGCTTCCTTACACTGGAGATTTCCTACCTGGTGAATTTTTAAA

AACCTTCTGCTTTCTGAAACTCCTTTGTCAGCAGATAGCGTCTGGGGAGGTGGGAGGAGTCACAGCATGCTCTTTTCTATCTGTCCAGATCATTAGGTTT

TTTTTTCCCCCTTTTAACACACTTTTTTAAAGGGATGGGAATTGAAGTTTTTTTTTTTTTTCTCAAAAGCTTTCATGAATTTAGAGCATTCTAGCTAATG

TAATAAAACCCTTTAAGAATGTCCGACTTCATCTGAATCCACGTCTGTTCTTTGTCTCCAGGCACCCACCCTGTGCTGCTGCATGCCACCCTTAATTCCT

GACTTTTTATATCTAGTCATGAAGGTGACTTTCAGCACAAAGGACACTTATAAACAAATTCTTATTTTTTTCTTACCAATGTAAGGTTTGGCACTCTTTT

CACTGGTGCCACTAGACTTATTGATTGTGACAACTCTAGACCTGCCTGCTTTATCTAATGTAATCATGCGCAATGTCTACAGGTTGTTTGATGATCGGCC

ACACAGAGAACGGAGGAACCAATGCTGTTTATTGTTTGCTATGATACAGAGCTGTACAAAAACTTACAATGAACATATTTTGTAGCTTAGTGATCTCCAC

GTACATAAAGGGACATATTAATACTGGTTGACTTGTAAATTGATACTCATGCCGATGTAGTAGATAGACCCCATGCTCCCACCTGCTTATGTGTTGCTCA

CACTGTGTGTGATTTGTCTCTTATGTTAAGCAGCACCTATGTCAACAGTACATATTCAGATGTGTTGAGCACTCCAGGTGTAGTCAGTAGGAAGTTCTTT

TACTGAGTACCGTTTTAATTTATAGACTGCCACGGCCTTAAGAACATTCTGGACAGATAACTGCACCATGTTGCACAGGCACTACTTGTTCTCTCCATTC

TCATTCTTACTGAGTAGGACCTGGGCTGGAAAGTTCTCTTCTTATTCACGGAGGCAGGTTGCACTCTTCCTGAATTGGATGGGTGGTTTGAATAAAGGGA

TATTTAAACTTTGCTCCTGTAGCCCGACATGACTAATGGTCACTGTGAACCATTTCAAAGAATGTGGCAACTTGCTTATGCCTAAAAGGAGGGATTGGAA

CCAGAATGTTTAACTAAGCGGGGACTGCATAAGTTCTTGTTAATTGACCTATGGAAACCTTAATTTGTTTATGTGTCTTTCCATTGCTTTCCAGCATTTC

AGGACATCTAAAAGCTACTACCAACATTTTCCTGTGCATAACCTCTGCATGTGAAAACCTAACAGTTACTGAACTTTGTAAATACGTAAATTTTTTATTT

AGGTGTGGATGCATTTTTTGTCTGTTTACTGCTCCTCTCAGCTTTATTCAATAAACTTGCATTTTGAGGGTTG
Translation
MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIA - UNI4725 - SGQFSEDMIPTVGFNMRKVTKGNVTIK IWDIGGQPRFRSMWERYC

RGVNAIV - UNI28199 - VYMIDAADREKIEASRNELHNLLDKPQLQGIP VLVLGNKRDLPNALDEKQLIEKM MNLSAIQDREICCYSISCKEKD

NID - UNI9956 - DITLQWLIQHSKSRRS

For any suggestions or comments, please send an email to unitrap@crg.es