Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030107 (Usp18)
Chromosomal location
Chr 6: 121195925 - 121220934 (+)
Description
ubiquitin specific peptidase 18 Gene [Source:MGI Symbol;Acc:MGI:1344364]
Human Ortholog
not available
Omim not available
UniTrap UNI38256
Vector Insertion
Chr 6: 121196081 - 121202334
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000032198
Sequence
GTGCCAGGGCGGCTGTGCCTAGGGGACAGCAGACACTCCTGAGCTGAGAGGCTGGGAGGCAGCAAGACTGCTCTGCTCCGCGGTGCCGCGTCCTCTTCTG

TAGCCCTTTGCAGATGCTGCTCGGTCTTCGCTCTTTGGCTTGACTCCGTGCTTGAG - UNI38256 - AGGGTCATTTGTCTCCGGCTTGTGTAGACT

CTGCCTGGAAGTGAAGTTGTGGACTCCCGACCTCCAGTCCCGCCAGTCCCAACCTCGGAGTTTGAGTGTGATCACTAATGGGCAAGGGGTTTGGGCTCCT

GAGGAAACCCTGCCAGTCAGTTGTGGCTGAGCCGCAGCAGTACTCAGCGCTGGAGGAAGAGAGGACCATGAAGAGGAAGAGAGTGCTGTCTAGAGACCTC

TGCAGTGCCTGGGACAGCCCTCATG GTCTGGTTGGTTTACACAACATCGGACAGACGTGTTGCCTTAACTCCTTGCTTCAAGTGTTCATGATGAACATG

GACTTCAGAATGATATTGAAGAG GATAACAGTGCCTCGGAGTGCAGAAGAGAGGAAGAGAAGTGTCCCCTTCCAGCTGCTTTTGCTGCTGGAGAAGATG

CAGGACAGTCGACAGAAAGCCGTGCTGCCCACGGAGCTCGTTCAGTGCCTGCAGAAATACAACGTGCCGT TGTTTGTCCAGCACGATGCTGCTCAACTC

TACCTTACAATCTGGAACCTGACTAAGGACCAGATCACGGACACAGACTTG ACAGAGCGGCTGCAGGGTCTGTTCACCATCTGGACGCAGGAGTCCCTG

ATTTGCGTGGGCTGTACAGCAGAGAGCAGCAGGAGGAGCAAACTGCTCACACTCTCTCTTCCTCTTTTTGATAAGGACGCAAAGCCTCTGAAAACCCTG 

GAGGATGCCTTGAGATGTTTCGTCCAGCCCAAAGAGTTAGCAAGCTCCGACATGTGCTGCGAGAGCTGTGGGGAGAAGACGCCTTGGAAACAG GTTCTG

AAGCTGACTCATCTGCCCCAAACCTTGACCATTCACCTCATGAGATTCTCTGCCAGGAACTCGAGGACGGAAAAGATCTGTCACTCAGTTAATTTCCCTC

AGAGCTTGGATTTCAGTCAGGTTCTGCCAACCGAGGAAGACCTCGGTGATACCAAGGAACAG TCTGAAATACACTATGAACTCTTTGCCGTGATTGCCC

ACGTTGGGATGGCTGACTTTGGTCATTACTGTGCCTACATCCGGAATCCCGTGGATGGAAAGTGGTTCTGCTTCAATGACTCACATGTTTGTTGG GTCA

CCTGGAAGGATGTCCAGTGTACCTATGGGAACCACAGATACCGCTG GCGGGAAACGGCCTATCTCTTGGTTTACACGAAGACTGGATCCTGACAGATAT

ACTCACACCTCCAGAGAGGGATAGACTCTTATCTCCTCTCCTGTACCCTTGTCTGCTGCATTTCAACGAGAATAATAATTTAAAAACAATTAAGCCCTAT

TTATAAGCAAAACTATTATTGCAATGGCTTAGATGTAGTTTGTCTCCTGAAAGCTCACACACGGAAGGCTTGGTCTTTAGATGGCAGTGCTTAGGTGACA

GAACTTGTAAGAGACAGGGACCAGTGGGAGATCATCGGTTCATGGGATCTCTCTCCTGAGCACTAATAGTTCTTCTTCCTGTTTCTCTACACATGTTGTG

ATGCAAATGTGGGGGATACAACATGCCAGGGCCAAGCTGGTTGGAGCCTCCAGCCTTCAAAATTCTGAATCTAATAAACATTATTGCACACT
Translation
 - UNI38256 - MGKGFGLLRKPCQSVVAEPQQYSALEEERTMKRKRVLSRDLCSAWDSPHG GLVGLHNIGQTCCLNSLLQVFMMNMDFRMILKR R

ITVPRSAEERKRSVPFQLLLLLEKMQDSRQKAVLPTELVQCLQKYNVPL LFVQHDAAQLYLTIWNLTKDQITDTDL TERLQGLFTIWTQESLICVGCT

AESSRRSKLLTLSLPLFDKDAKPLKTL EDALRCFVQPKELASSDMCCESCGEKTPWKQ VLKLTHLPQTLTIHLMRFSARNSRTEKICHSVNFPQSLDF

SQVLPTEEDLGDTKEQ SEIHYELFAVIAHVGMADFGHYCAYIRNPVDGKWFCFNDSHVCW VTWKDVQCTYGNHRYRW WRETAYLLVYTKTGS

For any suggestions or comments, please send an email to unitrap@crg.es