Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030110 (Ret)
Chromosomal location
Chr 6: 118101766 - 118147762 (-)
Description
ret proto-oncogene Gene [Source:MGI Symbol;Acc:MGI:97902]
RefSeq_dna
NM_001080780 NM_009050 
RefSeq_peptide
NP_001074249.1 NP_033076.2 
UniGene
Mm.57199 
MGI
MGI:97902 
Uniprot/SWISSPROT
P35546 
Uniprot/SPTREMBL
Q8C8Q7 
Human Ortholog
ENSG00000165731 (RET)
Omim 114500 - COLORECTAL CANCER  142623 - HIRSCHSPRUNG DISEASE, SUSCEPTIBILITY TO, 1  155240 - THYROID CARCINOMA, FAMILIAL MEDULLARY  162300 - MULTIPLE ENDOCRINE NEOPLASIA, TYPE IIB  171300 - PHEOCHROMOCYTOMA  171400 - MULTIPLE ENDOCRINE NEOPLASIA, TYPE IIA  188550 - THYROID CARCINOMA, PAPILLARY  191830 - RENAL ADYSPLASIA  209880 - AUTONOMIC CONTROL, CONGENITAL FAILURE OF  
UniTrap UNI34208
Vector Insertion
Chr 6: 118119850 - 118123687
Public Clones IST14679H4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34888
Vector Insertion
Chr 6: 118115927 - 118118037
Public Clones IST11830E8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000088790
Sequence
GACATCATTCTAGACTCTGGGTCTCTGCGAGTATAGGTGACCAGTCGGCCCAGACGCCGAATCTTCTGTGTTGCTCTTTCTGGGCGGCGGGAAAGGACTA

ACAGAAACAGCAAGCGAGACGCACGGGGTGAGAAAGTGGCTATGCCGGCAAATGATCATGGATCCAGGTTACCTTTAGTAGACCAGCACCCGCACCACAA

CCCACACGCACCCAGCTCCGACCCGCGCTCATCTAGAGAGGAAATAGAGGTTCCCCTAGCAGTCGGGTGCCGCCCCACCTTGCCCCACACAGTACCTGGA

GCCCCGCCCCTCCACACACACCCGCACCCCTGGTCCCGCCCCTCTCGCTGCCACTCCCTCTGCGCCCTGCCCTGCCCCAGTCCGCTCCCCGGGCGCAGGC

AGCGCAGGTCTCTCATCAGTACCGCAACCGGAGCCGTGCAAGCAACAGCAGAGAGCGGCTCCGAGTCCGCAGCTGGGAGTCGCGCCCGGACGCAACGCGC

CCGCAGTGCCCGCTGCGCCCGGGCTGGCATGGGGAGGCCCGGCTGAGCGCCGCACCCCACCGCCGCCGAGACCCGCCTGCTCCTCAACCGCGGCCCTCGC

GCGCACGGGCGATGGCGAAAGCGACGTCCGGCGCCGCAGGGCTGGGGCTGAAGCTGATTTTGCTCCTGCCGCTGCTAGGAGAAG CCCCACTGGGCCTCT

ATTTCTCAAGGGATGCTTACTGGGAGAGGCTGTATGTAGACCAGCCAGCTGGCACACCTCTGCTCTATGTCCATGCCCTACGGGATGCCCCTGGAGAAGT

GCCGAGCTTCCGCCTGGGCCAGCATCTCTATGGCGTCTACCGTACACGGCTGCATGAGAATGACTGGATCCGCATCAATGAGACTACTGGCCTTCTCTAC

CTCAATCAGAGCCTGGACCACAGTTCCTGGGAACAGCTCAGCATCCGCA ATGGTGGTTTCCCCCTGCTCACCATCTTCCTCCAGGTCTTTCTGGGGTCC

ACAGCCCAGAGAGAGGGAGAATGCCATTGGCCAGGCTGTACCCGTGTGTACTTCTCCTTCATCAACGACACCTTCCCAAATTGTAGCTCCTTCAAAGCCC

AGGATCTCTGCATCCCAGAGACAGCCGTGTCCTTCCGAGTCAGGGAGAACAGGCCTCCTGGCACCTTCTACCACTTCCACATGTTACCCGTGCAGTTCCT

TTGTCCCAACATCAGTGTGAAGTACAGTCTCTTAGGAG GGGATAGTCTGCCCTTCCGTTGTGACCCAGACTGCCTGGAGGTGAGCACTCGCTGGGCCCT

GGATCGAGAGCTCCGGGAGAAGTATGTGCTGGAGGCTTTGTGCATAGTGGCAGGCCCTGGTGCCAACAAAGAGACGGTGACTCTGTCCTTCCCAGTGACA

GTGTATGATGAGGACGACTCGGCGCCCACCTTCTCTGGAGGTGTGGGCACTGCCAGCGCGGTGGTGGAGTTTAAGCGGAAGGAG GGCACTGTGGTGGCC

ACCCTGCAGGTGTTCGATGCAGATGTGGTGCCAGCGTCTGGGGAGCTGGTGAGACGGTACACAAACACACTCCTCTCAGGGGACTCCTGGGCCCAGCAGA

CCTTCCGGGTGGAGCATTCGCCCATCGAGACCTTGGTCCAGGTCAACAACAACTCCGTTCGGGCAACCATGCACAATTACA AGCTGATTCTCAACAGGA

GCCTGTCTATCTCAGAGAGCCGAGTCCTGCAGCTCGCGGTCCTGGTCAACGACTCAGACTTCCAGGGGCCTGGGGCAGGTGGTATCCTCGTCCTCCATTT

CAACGTGTCTGTACTGCCCGTCACCCTGAACCTACCCAGGGCCTACTCCTTCCCAGTGAATAAGAGGGCCCGCCGCTATGCCCAG ATCGGGAAAGTCTG

TGTGGAAAACTGCCAGGAGTTCAGCGGTGTCTCCATCCAGTACAAGCTGCAGCCTTCCAGCATCAACTGCACTGCCCTAGGTGTGGTCACCTCACCCGAG

GACACCTCGGGGACCCTATTTGTAAATGACACAGAGGCCCTGCGGCGACCTGAGTGCACCAAGCTTCAGTACACGGTGGTAGCCACTGACCGGCAGACCC

GCAGACAGACCCAGGCTTCGCTAGTGGTCACTGTGGAGGGGACAT CCATTACTGAAGAAGTAGGCTGCCCCAAGTCCTGTGCAGTAAACAAGAGGCGCC

CCGAGTGTGAGGAATGTGGTGGCCTGGGTTCTCCAACTGGCAGGTGCGAGTGGCGCCAGGGAGATGGTAAAG GGATCACCAGGAACTTCTCCACCTGCT

CCCCCAGTACCAGGACCTGCCCCGACGGCCACTGTGATGCTGTGGAGAGCCGGGATGCCAACATTTGCCCCCAGGACTGTCTCC GTGCCGACATTGTTG

GAGGACACGAGCGAGGGGAGCGCCAGGGCATTAAAGCAGGCTACGGCATCTGCAACTGTTTCCCTGATGAGAAGAAATGCTTCTGCGAGCCAGAGGACAG

CCAGG - UNI34208 - GCCCACTGTGTGATGCGCTGTGCCGCACGATCATCACAGCTGCCCTCTTCTCCCTTATCATCTCCATCCTGCTGTCCATCT

TCTGTGTCTGCCACCACCACAAGCATGGGCACAAGCCGCCCATTGCATCAGCGGAAATGACCTTCTGCCGGCCGGCCCAGGGCTTCCCAATCAGTTATTC

CTCCTCAGGCACCCGCCGGCCCTCACTGGATTCCACGGAGAACCAGGTTCCTGTGGACTCTTTCAAGATCCCG - UNI34208 - GAGGATCCAAAGT

GGGAATTTCCTCGGAAGAACTTAGTTCTTGGGAAAACTCTGGGAGAAGGCGAGTTTGGAAAAGTTGTCAAGGCCACAGCCTTCCGTCTGAAAGGCCGGGC

AGGATACACCACAGTGGCTGTGAAAATGCTGAAAG - UNI34208 - AAAACGCCTCCCAGAGTGAGTTACGAGACCTGCTGTCTGAGTTCAACCTTC

TGAAACAAGTCAACCATCCACATGTCATCAAGTTGTATGGGGCCTGCAGCCAGGATG GGCCACTTCTTCTCATTGTGGAGTATGCCAAGTATGGCTCCC

TGCGGGGATTCCTCCGTGACAGCCGCAAGATTGGGCCTGCCTATGTGAGCGGTGGAGGCAGCCGCAACTCCAGCTCGCTGGACCACCCAGATGAAAGGGT

ACTGACCATGGGTGACCTCATCTCCTTCGCCTGGCAGATCTCGAGGGGTATGCAGTACTTGGCAGAAATGAAG - UNI34888 - CTTGTACATCGGG

ACTTAGCTGCCAGGAACATCTTGGTGGCTGAGGGACGGAAGATGAAGATTTCCGACTTTGGGCTGTCCCGAGATGTTTATGAGGAAGATTCCTATGTGAA

GAAAAGCAAG - UNI34888 - GGCCGGATTCCCGTCAAGTGGATGGCAATTGAGTCCCTTTTCGATCACATCTATACTACTCAAAGTGATGT - UN

I34888 - GTGGTCCTTTGGAGTGCTGCTCTGGGAGATTGTGACCCTGGGAGGCAACCCCTACCCTGGAATTCCTCCTGAACGACTCTTCAACCTTCTG

AAGACAGGCCACAGGATGGAGAGGCCAGACAACTGCAGCGAGGAAAT GTACCGTCTGATGCTGCAGTGCTGGAAGCAGGAGCCAGACAAGAGGCCAGTG

TTTGCTGACATCAGCAAGGATCTGGAGAAGATGATGGTCAAGAGCAGA GACTACTTGGACCTGGCTGCATCCACACCTTCGGACTCACTGCTGTATGAC

GATGGGCTCTCAGAAGAGGAGACACCCCTGGTGGACTGTAACAATGCTCCCCTCCCGCGCTCCCTCCCTTCCACATGGATTGAAAACAAACTCTATGGTA

GAATTTCACATGCATTTACTAGATTCTAGCAACGCTGTCCTCTCTGCACCATCCCAACTCTCTGTAACGCTTTTTAAAGAGTGTTTCTGATCCCACCGAC

ACCAAAGCCTCCTCCGAACCCTTTTCTTTGTAAATATCTGACTTTGCATCTAGTTTACATACATTCAGGCATTTTGCAGCTATGTCTTTCTAAAAGGATG

TGAAAATAAGTGTCATTACCACACAGCCCAGCAACTTACGATGACACAGGAGAAGCGGATTAGAGCAGAATTCTCAGGGCCCATTGGGAAGCAAATCATA

GTACTGGTGACTTCGATATTTAAATTTACCTGATCTGGGGAGGGAGTCAGTTTTGCCAGGGAAAGCTGGCATCCCCAGCTATGCTATCGTTGCAAGCTGG

GCTACCCCCAGGCTGCTCCTGGGCTGGTGTGTGCCTCGCGGAAGCCGACCATAATCCCACTTCCAGCTATGTGTCCACAGCCGTGCAGTGTGGGGCAGCG

GGAAAACCATGTGGGCCCTGGGCAGACACCAGACTGCTGCTTTCACATCCTTTGCACCCTACCCCCATCATGATGTTGTCACTCACGAAGCCAGTGCTAA

ATACTGAGCCAATGCTTTCTGAAAGAACATAGTCTGTGGTGCTGTGGCCTTGCAATGGACAGTAAATACGGCTCTTGCCAAAACTCCTTCTTTGTCTTGG

ATTAAATACTTGAAATTTTTTTTCTGCTTCCTAATCTCCTCATTGATGCTTTTTGAAGTCTTGCAGTTTCAAGCTAAGGTAGGTTCTTTCCTGCATGCTT

CCTGAGTCACAGGTCCTCACTACCTGCCTTGTGCCTACAGTGCTGCGGGGGCAGCCTGTGTGTGCCCCCTGTGGGAAAGGAAGTCTTCCTCCTCCGTGTT

AGCAGGGATGACAGGTGAACAGCCCCTAGAGGGTTCCCACTACAGGAAGCCATATAGTCCAGCCATTCGCTGATGCTTTACACTGTCCTGGGAAAACAGT

TGAGCATTTCACCAGATCTGTTTCAGATTTGAGACTCTAAACTCATAGGCTTTGAGATTTGGTAGCCTCTGCTAAATTACCTGTACCAGGAGCATGTAAG

GTTGCCCCATGTAGAACAGTGTTTTGGAAACCTGGGATGCAAAACCATTAATGGAATTGGCACGGAAAGCGCAAGTTGGTTTAACCATCAAAGGGAGTTT

TGCCAAGGCCTTACTGTCTGCACATGAAGTTTGAGTTCTTCAGTGCAGAACAAATTATCTGTTTTCATTTTTAGGCATGTCAGACCCGAACTGGCCTGGA

GAGAGTCCTGTACCACTCACGAGAGCCGATGGCACTAGCACTGGGTTCCCAAGATATGCAAATGATAGTGTATATGCTAACTGGATGGTTTCACCCTCAG

CGGCAAAATTAATGGACACATTTGATAGCTAACATTCCTTTGTGAACGGTAATGGACTCCCAAGGGGGAAGAAACATGCCAAGAGCATCAAGTCCACCGG

CCCCTTTGTGCACATCATACTGGCCAAGACCAGCCTTAGGTGGCAGACTTGTTTTCTGTAGTTTGTTTTAGCTGGTTTCCAAATGGTTTTACTTCAAATA

GCTGGTGGTCCTCCCTCCTGGTGGTCTGCCCTCCTAGCACACCTGCCCCATTGGGTGGGTGCTCTGAGTCTCTGGTTAGATCCCCTTTCCCTTTAGCATT

GGGTAGCACCTCTGTTGGTCTGCTCATCACTAGCCACCACGAGCTCTGTGTCCACATGTGTGGGGTCTGCCATTCATGACTTGGATGAGAAATTGTACCT

GAACTGTCTGATTTTCCTGGCTGATAAAAAACCTACCACGTCCCCCCAAAAATGTTTTAACATGAAGCACACATACAAACAACATTGATTGAAAAACCTG

GCCAGAACGACCTGTCCTTGTCTAGAATGAAAGCCTAGCATAGGACTGGGTAGTTGCATCCACCCGGGTCCACTAGGGCTGGAGGGGAGAAGGGAGCCTC

CGGGCTGTCCTCGGCTCAATATATGACATCCTGAATATAGATTTTTGGGTTTTTTAGCCATGTAGCCTTTTCTTAGGAAAATGTTTTGTTTCTGTCATGG

TTAAATGGCTCTTAGAATTAGCACAATGGAGAGATTTGGTGTTGCCTTTGCTATATACAAGGCAACTGGAAAGAAGTGACCCCACATGACCTAGTCCCCC

TGTTGAGCCCTCGGCAACATTCACGCTGCGTGACTCCGACTCACTGACCAGAACAGGGTGAAGAAGCGGGGCATTTGGAGTAGAGTTGCCTTCAGGTCCA

GTATTGCTGTCATCAGAGGCCTTGAGCCACAAATTCTGCACCCCCAGCAAGCCAGTCTGCAGTACACCCTACCCACCAAAGAGTGTGCCCACCCTCTGCT

TGGGGACAGGTGGGTCTGTCTTGTTTTAATCCCTGGCTTGCCAGCTCATGCCCAAAGGGAAGGACAGTTCATCTAGTTGCATTAGATGTTTCCCTGACAC

TGACTGAGGTGAGAGAACAAGGTTTTGGCTCTTATAGAGCTTGTGTGAAAGGCACATGGGTCAGCTCTTCCGGCCGTCCTTTATGCTGCTATGGTACGTG

TTTTGGTCTCTGTTCTAACCACGACTCACGTGTAAGGTTCTTGTCTTTCTATATGGGCAGTTGTAGCCACAGACACTCAGCACTCCTCTAGGGCTTTAGG

GGTGGCTCTTGGAAGTTTCTTTGGCTGTCTGTGGACTGTCACTTCCCATGAAAAGGTCACATTACCAAAACACTGCCTGGTCTTCAGACTTGAAGCACTG

TGATAGGACTTTAAATAGTCATAATAAAATACTATATCTTTATGGGCATTTCACAAACACAGTAAAATTGTGACATTTTATGTGGCTGAGAATGCTCAGA

TAAGTATACCAGATAGAGCCTTATGGAGTGTGTGTGATATTTGTGTGCACACATAGCCAGACAGACAGGAAGATGAAAAATGCTTATTTTAACATATAAT

ATGGCTTTAGTTTTGGGCCATTTTTTTTTCAGATACACTGTGATAAGGTTTTTTATATAAATATCTCTAGTCATGGGACCCATTTTGTTTTTTCAGATGT

GTTTAATGGTAGTTTTATTAAGTGCAAAAATACGGATGAATTCAAATTATTCAACATGCCTACACGGTAAGTGTGACTTGCTAGGGCAAGTTAGCTCTCA

AGGGCTGAGCTCCAAGTCTAAATAGCTGGCCCATTTGTGAGGAATTAACACTTGACTAATAACCATTGTCTGTCTGTTCCTGAGATATAAAAGCACCCAT

ACTTGTTAAAGTACCTATACTTGTTAGCACTATCAGACAGATTTTTCATCTACATATATGCAGAAGTTACCCCTTATTAAATATTACTGAGTATTAAGTA

GCTATCTGTCAGCCACTAAATTTGTAAGATCTATTTAAGAAAGGCCATTAAACCATACCGTGTTGACTTGTTTTTGTAATCAAGGTGACTAAGGAAATAA

TTTCAGTTGTGTAAATAAAATAAATCATAAAATGTGT
Translation
MAKATSGAAGLGLKLILLLPLLGEA APLGLYFSRDAYWERLYVDQPAGTPLLYVHALRDAPGEVPSFRLGQHLYGVYRTRLHENDWIRINETTGLLYLN

QSLDHSSWEQLSIRN NGGFPLLTIFLQVFLGSTAQREGECHWPGCTRVYFSFINDTFPNCSSFKAQDLCIPETAVSFRVRENRPPGTFYHFHMLPVQFL

CPNISVKYSLLGG GDSLPFRCDPDCLEVSTRWALDRELREKYVLEALCIVAGPGANKETVTLSFPVTVYDEDDSAPTFSGGVGTASAVVEFKRKE GTV

VATLQVFDADVVPASGELVRRYTNTLLSGDSWAQQTFRVEHSPIETLVQVNNNSVRATMHNYK KLILNRSLSISESRVLQLAVLVNDSDFQGPGAGGIL

VLHFNVSVLPVTLNLPRAYSFPVNKRARRYAQ IGKVCVENCQEFSGVSIQYKLQPSSINCTALGVVTSPEDTSGTLFVNDTEALRRPECTKLQYTVVAT

DRQTRRQTQASLVVTVEGTS SITEEVGCPKSCAVNKRRPECEECGGLGSPTGRCEWRQGDGKG GITRNFSTCSPSTRTCPDGHCDAVESRDANICPQD

CLR RADIVGGHERGERQGIKAGYGICNCFPDEKKCFCEPEDSQG - UNI34208 - GPLCDALCRTIITAALFSLIISILLSIFCVCHHHKHGHKPP

IASAEMTFCRPAQGFPISYSSSGTRRPSLDSTENQVPVDSFKIP - UNI34208 - EDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFRLKGRAGYTT

VAVKMLKE - UNI34208 - ENASQSELRDLLSEFNLLKQVNHPHVIKLYGACSQDG GPLLLIVEYAKYGSLRGFLRDSRKIGPAYVSGGGSRNSSS

LDHPDERVLTMGDLISFAWQISRGMQYLAEMK - UNI34888 - LVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKKSK - UNI34888 -

 GRIPVKWMAIESLFDHIYTTQSDV - UNI34888 - VWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEM MYRLMLQCWKQEP

DKRPVFADISKDLEKMMVKSR DYLDLAASTPSDSLLYDDGLSEEETPLVDCNNAPLPRSLPSTWIENKLYGRISHAFTRF
Transcript ENSMUST00000032201
Sequence
GACATCATTCTAGACTCTGGGTCTCTGCGAGTATAGGTGACCAGTCGGCCCAGACGCCGAATCTTCTGTGTTGCTCTTTCTGGGCGGCGGGAAAGGACTA

ACAGAAACAGCAAGCGAGACGCACGGGGTGAGAAAGTGGCTATGCCGGCAAATGATCATGGATCCAGGTTACCTTTAGTAGACCAGCACCCGCACCACAA

CCCACACGCACCCAGCTCCGACCCGCGCTCATCTAGAGAGGAAATAGAGGTTCCCCTAGCAGTCGGGTGCCGCCCCACCTTGCCCCACACAGTACCTGGA

GCCCCGCCCCTCCACACACACCCGCACCCCTGGTCCCGCCCCTCTCGCTGCCACTCCCTCTGCGCCCTGCCCTGCCCCAGTCCGCTCCCCGGGCGCAGGC

AGCGCAGGTCTCTCATCAGTACCGCAACCGGAGCCGTGCAAGCAACAGCAGAGAGCGGCTCCGAGTCCGCAGCTGGGAGTCGCGCCCGGACGCAACGCGC

CCGCAGTGCCCGCTGCGCCCGGGCTGGCATGGGGAGGCCCGGCTGAGCGCCGCACCCCACCGCCGCCGAGACCCGCCTGCTCCTCAACCGCGGCCCTCGC

GCGCACGGGCGATGGCGAAAGCGACGTCCGGCGCCGCAGGGCTGGGGCTGAAGCTGATTTTGCTCCTGCCGCTGCTAGGAGAAG CCCCACTGGGCCTCT

ATTTCTCAAGGGATGCTTACTGGGAGAGGCTGTATGTAGACCAGCCAGCTGGCACACCTCTGCTCTATGTCCATGCCCTACGGGATGCCCCTGGAGAAGT

GCCGAGCTTCCGCCTGGGCCAGCATCTCTATGGCGTCTACCGTACACGGCTGCATGAGAATGACTGGATCCGCATCAATGAGACTACTGGCCTTCTCTAC

CTCAATCAGAGCCTGGACCACAGTTCCTGGGAACAGCTCAGCATCCGCA ATGGTGGTTTCCCCCTGCTCACCATCTTCCTCCAGGTCTTTCTGGGGTCC

ACAGCCCAGAGAGAGGGAGAATGCCATTGGCCAGGCTGTACCCGTGTGTACTTCTCCTTCATCAACGACACCTTCCCAAATTGTAGCTCCTTCAAAGCCC

AGGATCTCTGCATCCCAGAGACAGCCGTGTCCTTCCGAGTCAGGGAGAACAGGCCTCCTGGCACCTTCTACCACTTCCACATGTTACCCGTGCAGTTCCT

TTGTCCCAACATCAGTGTGAAGTACAGTCTCTTAGGAG GGGATAGTCTGCCCTTCCGTTGTGACCCAGACTGCCTGGAGGTGAGCACTCGCTGGGCCCT

GGATCGAGAGCTCCGGGAGAAGTATGTGCTGGAGGCTTTGTGCATAGTGGCAGGCCCTGGTGCCAACAAAGAGACGGTGACTCTGTCCTTCCCAGTGACA

GTGTATGATGAGGACGACTCGGCGCCCACCTTCTCTGGAGGTGTGGGCACTGCCAGCGCGGTGGTGGAGTTTAAGCGGAAGGAG GGCACTGTGGTGGCC

ACCCTGCAGGTGTTCGATGCAGATGTGGTGCCAGCGTCTGGGGAGCTGGTGAGACGGTACACAAACACACTCCTCTCAGGGGACTCCTGGGCCCAGCAGA

CCTTCCGGGTGGAGCATTCGCCCATCGAGACCTTGGTCCAGGTCAACAACAACTCCGTTCGGGCAACCATGCACAATTACA AGCTGATTCTCAACAGGA

GCCTGTCTATCTCAGAGAGCCGAGTCCTGCAGCTCGCGGTCCTGGTCAACGACTCAGACTTCCAGGGGCCTGGGGCAGGTGGTATCCTCGTCCTCCATTT

CAACGTGTCTGTACTGCCCGTCACCCTGAACCTACCCAGGGCCTACTCCTTCCCAGTGAATAAGAGGGCCCGCCGCTATGCCCAG ATCGGGAAAGTCTG

TGTGGAAAACTGCCAGGAGTTCAGCGGTGTCTCCATCCAGTACAAGCTGCAGCCTTCCAGCATCAACTGCACTGCCCTAGGTGTGGTCACCTCACCCGAG

GACACCTCGGGGACCCTATTTGTAAATGACACAGAGGCCCTGCGGCGACCTGAGTGCACCAAGCTTCAGTACACGGTGGTAGCCACTGACCGGCAGACCC

GCAGACAGACCCAGGCTTCGCTAGTGGTCACTGTGGAGGGGACAT CCATTACTGAAGAAGTAGGCTGCCCCAAGTCCTGTGCAGTAAACAAGAGGCGCC

CCGAGTGTGAGGAATGTGGTGGCCTGGGTTCTCCAACTGGCAGGTGCGAGTGGCGCCAGGGAGATGGTAAAG GGATCACCAGGAACTTCTCCACCTGCT

CCCCCAGTACCAGGACCTGCCCCGACGGCCACTGTGATGCTGTGGAGAGCCGGGATGCCAACATTTGCCCCCAGGACTGTCTCC GTGCCGACATTGTTG

GAGGACACGAGCGAGGGGAGCGCCAGGGCATTAAAGCAGGCTACGGCATCTGCAACTGTTTCCCTGATGAGAAGAAATGCTTCTGCGAGCCAGAGGACAG

CCAGG - UNI34208 - GCCCACTGTGTGATGCGCTGTGCCGCACGATCATCACAGCTGCCCTCTTCTCCCTTATCATCTCCATCCTGCTGTCCATCT

TCTGTGTCTGCCACCACCACAAGCATGGGCACAAGCCGCCCATTGCATCAGCGGAAATGACCTTCTGCCGGCCGGCCCAGGGCTTCCCAATCAGTTATTC

CTCCTCAGGCACCCGCCGGCCCTCACTGGATTCCACGGAGAACCAGGTTCCTGTGGACTCTTTCAAGATCCCG - UNI34208 - GAGGATCCAAAGT

GGGAATTTCCTCGGAAGAACTTAGTTCTTGGGAAAACTCTGGGAGAAGGCGAGTTTGGAAAAGTTGTCAAGGCCACAGCCTTCCGTCTGAAAGGCCGGGC

AGGATACACCACAGTGGCTGTGAAAATGCTGAAAG - UNI34208 - AAAACGCCTCCCAGAGTGAGTTACGAGACCTGCTGTCTGAGTTCAACCTTC

TGAAACAAGTCAACCATCCACATGTCATCAAGTTGTATGGGGCCTGCAGCCAGGATG GGCCACTTCTTCTCATTGTGGAGTATGCCAAGTATGGCTCCC

TGCGGGGATTCCTCCGTGACAGCCGCAAGATTGGGCCTGCCTATGTGAGCGGTGGAGGCAGCCGCAACTCCAGCTCGCTGGACCACCCAGATGAAAGGGT

ACTGACCATGGGTGACCTCATCTCCTTCGCCTGGCAGATCTCGAGGGGTATGCAGTACTTGGCAGAAATGAAG - UNI34888 - CTTGTACATCGGG

ACTTAGCTGCCAGGAACATCTTGGTGGCTGAGGGACGGAAGATGAAGATTTCCGACTTTGGGCTGTCCCGAGATGTTTATGAGGAAGATTCCTATGTGAA

GAAAAGCAAG - UNI34888 - GGCCGGATTCCCGTCAAGTGGATGGCAATTGAGTCCCTTTTCGATCACATCTATACTACTCAAAGTGATGT - UN

I34888 - GTGGTCCTTTGGAGTGCTGCTCTGGGAGATTGTGACCCTGGGAGGCAACCCCTACCCTGGAATTCCTCCTGAACGACTCTTCAACCTTCTG

AAGACAGGCCACAGGATGGAGAGGCCAGACAACTGCAGCGAGGAAAT GTACCGTCTGATGCTGCAGTGCTGGAAGCAGGAGCCAGACAAGAGGCCAGTG

TTTGCTGACATCAGCAAGGATCTGGAGAAGATGATGGTCAAGAGCAGA GACTACTTGGACCTGGCTGCATCCACACCTTCGGACTCACTGCTGTATGAC

GATGGGCTCTCAGAAGAGGAGACACCCCTGGTGGACTGTAACAATGCTCCCCTCCCGCGCTCCCTCCCTTCCACATGGATTGAAAACAAACTCTATG GC

ATGTCAGACCCGAACTGGCCTGGAGAGAGTCCTGTACCACTCACGAGAGCCGATGGCACTAGCACTGGGTTCCCAAGATATGCAAATGATAGTGTATATG

CTAACTGGATGGTTTCACCCTCAGCGGCAAAATTAATGGACACATTTGATAGCTAACATTCCTTTGTGAACGGTAATGGACTCCCAAGGGGGAAGAAACA

TGCCAAGAGCATCAAGTCCACCGGCCCCTTTGTGCACATCATACTGGCCAAGACCAGCCTTAGGTGGCAGACTTGTTTTCTGTAGTTTGTTTTAGCTGGT

TTCCAAATGGTTTTACTTCAAATAGCTGGTGGTCCTCCCTCCTGGTGGTCTGCCCTCCTAGCACACCTGCCCCATTGGGTGGGTGCTCTGAGTCTCTGGT

TAGATCCCCTTTCCCTTTAGCATTGGGTAGCACCTCTGTTGGTCTGCTCATCACTAGCCACCACGAGCTCTGTGTCCACATGTGTGGGGTCTGCCATTCA

TGACTTGGATGAGAAATTGTACCTGAACTGTCTGATTTTCCTGGCTGATAAAAAACCTACCACGTCCCCCCAAAAATGTTTTAACATGAAGCACACATAC

AAACAACATTGATTGAAAAACCTGGCCAGAACGACCTGTCCTTGTCTAGAATGAAAGCCTAGCATAGGACTGGGTAGTTGCATCCACCCGGGTCCACTAG

GGCTGGAGGGGAGAAGGGAGCCTCCGGGCTGTCCTCGGCTCAATATATGACATCCTGAATATAGATTTTTGGGTTTTTTAGCCATGTAGCCTTTTCTTAG

GAAAATGTTTTGTTTCTGTCATGGTTAAATGGCTCTTAGAATTAGCACAATGGAGAGATTTGGTGTTGCCTTTGCTATATACAAGGCAACTGGAAAGAAG

TGACCCCACATGACCTAGTCCCCCTGTTGAGCCCTCGGCAACATTCACGCTGCGTGACTCCGACTCACTGACCAGAACAGGGTGAAGAAGCGGGGCATTT

GGAGTAGAGTTGCCTTCAGGTCCAGTATTGCTGTCATCAGAGGCCTTGAGCCACAAATTCTGCACCCCCAGCAAGCCAGTCTGCAGTACACCCTACCCAC

CAAAGAGTGTGCCCACCCTCTGCTTGGGGACAGGTGGGTCTGTCTTGTTTTAATCCCTGGCTTGCCAGCTCATGCCCAAAGGGAAGGACAGTTCATCTAG

TTGCATTAGATGTTTCCCTGACACTGACTGAGGTGAGAGAACAAGGTTTTGGCTCTTATAGAGCTTGTGTGAAAGGCACATGGGTCAGCTCTTCCGGCCG

TCCTTTATGCTGCTATGGTACGTGTTTTGGTCTCTGTTCTAACCACGACTCACGTGTAAGGTTCTTGTCTTTCTATATGGGCAGTTGTAGCCACAGACAC

TCAGCACTCCTCTAGGGCTTTAGGGGTGGCTCTTGGAAGTTTCTTTGGCTGTCTGTGGACTGTCACTTCCCATGAAAAGGTCACATTACCAAAACACTGC

CTGGTCTTCAGACTTGAAGCACTGTGATAGGACTTTAAATAGTCATAATAAAATACTATATCTTTATGGGCATTTCACAAACACAGTAAAATTGTGACAT

TTTATGTGGCTGAGAATGCTCAGATAAGTATACCAGATAGAGCCTTATGGAGTGTGTGTGATATTTGTGTGCACACATAGCCAGACAGACAGGAAGATGA

AAAATGCTTATTTTAACATATAATATGGCTTTAGTTTTGGGCCATTTTTTTTTCAGATACACTGTGATAAGGTTTTTTATATAAATATCTCTAGTCATGG

GACCCATTTTGTTTTTTCAGATGTGTTTAATGGTAGTTTTATTAAGTGCAAAAATACGGATGAATTCAAATTATTCAACATGCCTACACGGTAAGTGTGA

CTTGCTAGGGCAAGTTAGCTCTCAAGGGCTGAGCTCCAAGTCTAAATAGCTGGCCCATTTGTGAGGAATTAACACTTGACTAATAACCATTGTCTGTCTG

TTCCTGAGATATAAAAGCACCCATACTTGTTAAAGTACCTATACTTGTTAGCACTATCAGACAGATTTTTCATCTACATATATGCAGAAGTTACCCCTTA

TTAAATATTACTGAGTATTAAGTAGCTATCTGTCAGCCACTAAATTTGTAAGATCTATTTAAGAAAGGCCATTAAACCATACCGTGTTGACTTGTTTTTG

TAATCAAGGTGACTAAGGAAATAATTTCAGTTGTGTAAATAAAATAAATCATAAAATGTGT
Translation
MAKATSGAAGLGLKLILLLPLLGEA APLGLYFSRDAYWERLYVDQPAGTPLLYVHALRDAPGEVPSFRLGQHLYGVYRTRLHENDWIRINETTGLLYLN

QSLDHSSWEQLSIRN NGGFPLLTIFLQVFLGSTAQREGECHWPGCTRVYFSFINDTFPNCSSFKAQDLCIPETAVSFRVRENRPPGTFYHFHMLPVQFL

CPNISVKYSLLGG GDSLPFRCDPDCLEVSTRWALDRELREKYVLEALCIVAGPGANKETVTLSFPVTVYDEDDSAPTFSGGVGTASAVVEFKRKE GTV

VATLQVFDADVVPASGELVRRYTNTLLSGDSWAQQTFRVEHSPIETLVQVNNNSVRATMHNYK KLILNRSLSISESRVLQLAVLVNDSDFQGPGAGGIL

VLHFNVSVLPVTLNLPRAYSFPVNKRARRYAQ IGKVCVENCQEFSGVSIQYKLQPSSINCTALGVVTSPEDTSGTLFVNDTEALRRPECTKLQYTVVAT

DRQTRRQTQASLVVTVEGTS SITEEVGCPKSCAVNKRRPECEECGGLGSPTGRCEWRQGDGKG GITRNFSTCSPSTRTCPDGHCDAVESRDANICPQD

CLR RADIVGGHERGERQGIKAGYGICNCFPDEKKCFCEPEDSQG - UNI34208 - GPLCDALCRTIITAALFSLIISILLSIFCVCHHHKHGHKPP

IASAEMTFCRPAQGFPISYSSSGTRRPSLDSTENQVPVDSFKIP - UNI34208 - EDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFRLKGRAGYTT

VAVKMLKE - UNI34208 - ENASQSELRDLLSEFNLLKQVNHPHVIKLYGACSQDG GPLLLIVEYAKYGSLRGFLRDSRKIGPAYVSGGGSRNSSS

LDHPDERVLTMGDLISFAWQISRGMQYLAEMK - UNI34888 - LVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKKSK - UNI34888 -

 GRIPVKWMAIESLFDHIYTTQSDV - UNI34888 - VWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEM MYRLMLQCWKQEP

DKRPVFADISKDLEKMMVKSR DYLDLAASTPSDSLLYDDGLSEEETPLVDCNNAPLPRSLPSTWIENKLYG GMSDPNWPGESPVPLTRADGTSTGFPR

YANDSVYANWMVSPSAAKLMDTFDS

For any suggestions or comments, please send an email to unitrap@crg.es