Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030125 (Lrrc23)
Chromosomal location
Chr 6: 124719881 - 124729745 (-)
Description
leucine rich repeat containing 23 Gene [Source:MGI (curated);Acc:Lrrc23-001]
RefSeq_dna
NM_013588 
RefSeq_peptide
NP_038616.1 
UniGene
Mm.3207 
MGI
MGI:1315192 
Uniprot/SWISSPROT
O35125 
Human Ortholog
ENSG00000010626 (LRRC23)
Omim not available
UniTrap UNI25959
Vector Insertion
Chr 6: 124728364 - 124728834
Public Clones not available
Private Clones OST149163 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25268
Vector Insertion
Chr 6: 124726219 - 124728109
Public Clones not available
Private Clones OST189788 (lexicon) OST128310 (lexicon)
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13424
Vector Insertion
Chr 6: 124720894 - 124724363
Public Clones CMHD-GT_314C04-3 (cmhd) CMHD-GT_310E10-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29277
Vector Insertion
Chr 6: 124720182 - 124720589
Public Clones not available
Private Clones OST959 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13410
Vector Insertion
Chr 6: 124719880 - 124720182
Public Clones CMHD-GT_310G11-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112475
Sequence
GCGTCTTCCAAAAAAACAGTCTTGGCGTCTCAGCACAAAGATCCTCTCCTTAACTACTTCTAGAGGAGCAGAGTCAGG AGCGCAGGGCAGAGAAAGATG

TCGGATGAAGATGATGTGGATGACGTTGATGCAGAACAGGATGAAGTGGAAAGTGACAAGGAGATAGAGGAATGGGAAGACTACAGGAAAGAGACAGAAG

AAGCCTCTGAGGAA TGGCTGCCCACCCCCATCACGGAGGCCATGATGAAGGAAGGGCTCTCATTACTCTGCAAGATTGGCAGTGGACTGGCTCACGCTT

ATATTAAGCTGGAGGCTAAGGACAG - UNI25959 - GGACCTCACAGACATCTCCTTACTGCGCTCCTATATCCATCTTCGCTATGTGGATATTTCT

GAGAACCATATTACAGACATATCGCCGCTCAACAGTCTCACTCACCTCCTATGGCTCAAGGCCGATGGCAATCAGCTTCGGAGTGCTAGGATGAATGAAC

TTCCCTACCTGCAGATCGCCAGCTTTTCCTACAACCAGATCATAGACACTGAAGGCATCTTTCACCCCCGTCTGGGAAGCCTGGATCTCAAAG - UNI2

5268 - GGAACCGCATCCACCAGGTGACTGGTCTGGACCCCGAGAGACTGTCGAGCCTGCACACCCTGGAGCTTCGAGGGAACCAGCTGGAATCCACAA

AGGGAATCTACCTTCCTAAGCTGAAGAATCTCTACCTG GCTCAAAACCTGCTGAAGAAGGTAGAGGGCCTGGAGAACCTGAGCAACTTGACCACCCTGC

ATCTGCGAGACAACCAGATTGAAACTTTGAATGGCTTCTCCCAGGAAATGAAGTCGCTGCAGTACCTCAACTTGAG - UNI13424 - GAGCAATATG

ATTAGTGATCTGGCAGAGCTGGCCAAACTGCGGGACCTGCCCAAACTTCGAGCCCTGGTGCTGCTGGACAACCCATGTGCGGATGAGACCGACTACCGCC

AGGAGGCCCTGGTGCAGATGGCGCACCTTGAGCGCCTGGACAAAGAATTCTATGAGGATGATGACCGGGCAGAGGCCGAGGAGATCCGTCAGAGGCTGAA

GGAGGAACAGGATCAAGATCTCGATCCGGACCAGGACATGGAACCGTACTTGCCACCAGTTTAGTGGCTCTTCCAGCCTGCAGGGACAGTAAAG - UNI

13410 - - UNI29277 - GAAGCCATGGACACTGGCCCCAAGAACTGATAAGACTCCAGTGGGGGACCACCACATTCATAGCCCCGTCACAGGAAGT

GGGAGATGCTCCTTTTTGTCCCAGACTGGAAATCCATCACATCCCAAGGCTCCTTGGCAGTCATCTGTCTGTGTGGCTTGTTCTGTGGGCCTGAACTCCT

AAGCACAGGTCGGGGGTAAAACTAGGATGCTAGTAGGTGTTGTCTATAGAGAGGCGCTGAGGAAGTGAGCTGTGATGGGCCAGTTGAGGTTTCAAATAAA

AAGGCATTTTTTTAT
Translation
 MSDEDDVDDVDAEQDEVESDKEIEEWEDYRKETEEASEE WLPTPITEAMMKEGLSLLCKIGSGLAHAYIKLEAKDR - UNI25959 - RDLTDISL

LRSYIHLRYVDISENHITDISPLNSLTHLLWLKADGNQLRSARMNELPYLQIASFSYNQIIDTEGIFHPRLGSLDLKG - UNI25268 - GNRIHQVT

GLDPERLSSLHTLELRGNQLESTKGIYLPKLKNLYL AQNLLKKVEGLENLSNLTTLHLRDNQIETLNGFSQEMKSLQYLNLR - UNI13424 - RSN

MISDLAELAKLRDLPKLRALVLLDNPCADETDYRQEALVQMAHLERLDKEFYEDDDRAEAEEIRQRLKEEQDQDLDPDQDMEPYLPPV - UNI13410 

- - UNI29277 - 
Transcript ENSMUST00000032218
Sequence
AAAAAAACAGTCTTGGCGTCTCAGCACAAAGATCCTCTCCTTAACTACTTCTAGAGGAGCAGAGTCAGG GACCAGGACTGAGTCTCATCTGACTCCAGA

GCGCAGGGCAGAGAAAGATGTCGGATGAAGATGATGTGGATGACGTTGATGCAGAACAGGATGAAGTGGAAAGTGACAAGGAGATAGAGGAATGGGAAGA

CTACAGGAAAGAGACAGAAGAAGCCTCTGAGGAA TGGCTGCCCACCCCCATCACGGAGGCCATGATGAAGGAAGGGCTCTCATTACTCTGCAAGATTGG

CAGTGGACTGGCTCACGCTTATATTAAGCTGGAGGCTAAGGACAG - UNI25959 - GGACCTCACAGACATCTCCTTACTGCGCTCCTATATCCATC

TTCGCTATGTGGATATTTCTGAGAACCATATTACAGACATATCGCCGCTCAACAGTCTCACTCACCTCCTATGGCTCAAGGCCGATGGCAATCAGCTTCG

GAGTGCTAGGATGAATGAACTTCCCTACCTGCAGATCGCCAGCTTTTCCTACAACCAGATCATAGACACTGAAGGCATCTTTCACCCCCGTCTGGGAAGC

CTGGATCTCAAAG - UNI25268 - GGAACCGCATCCACCAGGTGACTGGTCTGGACCCCGAGAGACTGTCGAGCCTGCACACCCTGGAGCTTCGAGG

GAACCAGCTGGAATCCACAAAGGGAATCTACCTTCCTAAGCTGAAGAATCTCTACCTG GCTCAAAACCTGCTGAAGAAGGTAGAGGGCCTGGAGAACCT

GAGCAACTTGACCACCCTGCATCTGCGAGACAACCAGATTGAAACTTTGAATGGCTTCTCCCAGGAAATGAAGTCGCTGCAGTACCTCAACTTGAG - U

NI13424 - GAGCAATATGATTAGTGATCTGGCAGAGCTGGCCAAACTGCGGGACCTGCCCAAACTTCGAGCCCTGGTGCTGCTGGACAACCCATGTGC

GGATGAGACCGACTACCGCCAGGAGGCCCTGGTGCAGATGGCGCACCTTGAGCGCCTGGACAAAGAATTCTATGAGGATGATGACCGGGCAGAGGCCGAG

GAGATCCGTCAGAGGCTGAAGGAGGAACAGGATCAAGATCTCGATCCGGACCAGGACATGGAACCGTACTTGCCACCAGTTTAGTGGCTCTTCCAGCCTG

CAGGGACAGTAAAG - UNI13410 - - UNI29277 - GAAGCCATGGACACTGGCCCCAAGAACTGATAAGACTCCAGTGGGGGACCACCACATTC

ATAGCCCCGTCACAGGAAGTGGGAGATGCTCCTTTTTGTCCCAGACTGGAAATCCATCACATCCCAAGGCTCCTTGGCAGTCATCTGTCTGTGTGGCTTG

TTCTGTGGGCCTGAACTCCTAAGCACAGGTCGGGGGTAAAACTAGGATGCTAGTAGGTGTTGTCTATAGAGAGGCGCTGAGGAAGTGAGCTGTGATGGGC

CAGTTGAGGTTTCAAATAAAAAGGCATTTTTTTATATTTTTG
Translation
 MSDEDDVDDVDAEQDEVESDKEIEEWEDYRKETEEASEE WLPTPITEAMMKEGLSLLCKIGSGLAHAYIKLEAKDR - UNI25959 - RDLTDISL

LRSYIHLRYVDISENHITDISPLNSLTHLLWLKADGNQLRSARMNELPYLQIASFSYNQIIDTEGIFHPRLGSLDLKG - UNI25268 - GNRIHQVT

GLDPERLSSLHTLELRGNQLESTKGIYLPKLKNLYL AQNLLKKVEGLENLSNLTTLHLRDNQIETLNGFSQEMKSLQYLNLR - UNI13424 - RSN

MISDLAELAKLRDLPKLRALVLLDNPCADETDYRQEALVQMAHLERLDKEFYEDDDRAEAEEIRQRLKEEQDQDLDPDQDMEPYLPPV - UNI13410 

- - UNI29277 - 

For any suggestions or comments, please send an email to unitrap@crg.es