Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030157 (Clec2d)
Chromosomal location
Chr 6: 129130640 - 129136552 (+)
Description
C-type lectin domain family 2, member d Gene [Source:MGI Symbol;Acc:MGI:2135589]
RefSeq_dna
NM_053109 
RefSeq_peptide
NP_444339.1 
UniGene
Mm.197536 
MGI
MGI:2135589 
Uniprot/SWISSPROT
Q91V08 
Human Ortholog
not available
Omim not available
UniTrap UNI34884
Vector Insertion
Chr 6: 129130766 - 129133109
Public Clones IST10720D12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000032260
Sequence
GTGCCTCTCAGCTTTCAAGTTTCAATCCTGTAGTGGAAACTCAGCTCCTCAGCTCTGAGATGTGTGTCACAAAGGCTTCCCTACCTATGCTTAGTCCCAC

AGGCAGCCCGCAGGAGGTAGAAGTGG - UNI34884 - GTAAAATTCTCCAAGGAAAAAGGCACGGAACCATCTCCCCTGAGTCTTGTGCTAAGCTTT

ACTGCTACTATGGAGTGATCATGGTCCTCACTGTAGCTGTAATTGCTCTTTCTGTTGCTTTGTCAG CAACAAAGACAGAACAGATCCCAGTCAACAAGA

CCTATGCTGCTTGCCCGCAAAACTGGATTGGAGTTGAAAATAAATGTTTTTATTTTTCTGAATACCCAAGTAACTGGACATTCGCCCAGGCCTTCTGCAT

GGCACAAGAGGCCCAACTAGCTCGGTTTGACAACCAGGATGAGCTG AATTTCCTAATGAGATACAAGGCGAATTTTGATTCCTGGATTGGCCTGCACAG

AGAGTCGTCAGAGCACCCTTGGAAGTGGACAGACAACACTGAGTATAACAACAC GATTCCCATCCGGGGAGAGGAAAGATTTGCCTACCTGAACAACAA

CGGGATCAGCAGTACCAGGATCTATTCACTTCGGATGTGGATCTGTAGCAAGCTCAACAGCTATAGCCTCCACTGCCAAACTCCTTTTTTTCCTTCCTAG

CATTTACCAAGAGACGCTTTTTAGCCTGTTATCTGTGGGTGCTACTCTTTCCCCTATGGTCCCAAAGTGCTATCAAACCAGATAGAGAATATTTCTTAAC

ATCAGAAATGAAAACCATCATTTCATTTCATGCAGAGATTGTTCAGTGGTTAAAATCACTGACTACTCTTCCGAAGGTCCTGAGTTCACATCTGAGCAAC

CACATGGTGGCTCACAAACATCCGTAATGAGATCTTCTGAGGTGTATGAAAACAGCTACACTGTACTTTATACTCTGCAATTTAAAGCATGAGGGACATA

GGAGAGTTAGCTACCCCACACTGATGAGTCCCAAAAAGGACGAAATAACAGGCTAAAAAGCCTCTCTTGAACTCTTCATCCTTTCTTCTCCCTCTTGGTC

TTTTTAAAGACCAGGTCGCTGAGGAGAAAGAGATGGAGAAATGGGGGAAGGGAAGGGGAGAGGGACATGATTGGGGGAGGGGAGGGGAGGGAAATTAATA

AAAAAATAAAACCAAAATACTAC
Translation
MCVTKASLPMLSPTGSPQEVEVG - UNI34884 - GKILQGKRHGTISPESCAKLYCYYGVIMVLTVAVIALSVALSA ATKTEQIPVNKTYAACPQN

WIGVENKCFYFSEYPSNWTFAQAFCMAQEAQLARFDNQDEL NFLMRYKANFDSWIGLHRESSEHPWKWTDNTEYNNT TIPIRGEERFAYLNNNGISST

RIYSLRMWICSKLNSYSLHCQTPFFPS

For any suggestions or comments, please send an email to unitrap@crg.es