Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030170 (Wnt5b)
Chromosomal location
Chr 6: 119382549 - 119494336 (-)
Description
wingless-related MMTV integration site 5B Gene [Source:MGI (curated);Acc:Wnt5b-001]
RefSeq_peptide
NP_033551.2 
UniGene
Mm.321818 
MGI
MGI:98959 
Uniprot/SWISSPROT
P22726 
Human Ortholog
ENSG00000111186 (WNT5B)
Omim not available
UniTrap UNI38154
Vector Insertion
Chr 6: 119417116 - 119494337
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31795
Vector Insertion
Chr 6: 119399234 - 119417230
Public Clones IST14244B5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32469
Vector Insertion
Chr 6: 119396352 - 119398291
Public Clones IST14024D6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000032273
Sequence
CCTTGCTGCTTCTCATTCCATGAGCTGGGGAGAGACAGTGTGGAAGTCAAACCATGTCTTTCTTGAGAGCAGGTGCTGCTGGGGTTCCCTGAATGGCGGC

TAGGTGCCAAGAG - UNI31795 - - UNI32469 - GGAGCTCCGCTTTGGAAGATGTTGGTCCCAGGGCATTGGGATGGGTTGAGGCCGGCCATG

CCCAGCCTGCTGCTGGTGGTCGTGGCAGCTCTGCTCTCCAGCTGGGCACAGCTGCTGACTGACGCCAACTCCTGGTG - UNI32469 - GTCACTAGC

TCTGAACCCAGTGCAGAGACCGGAGATGTTCATCATTGGCGCTCAGCCCGTGTGCAGCCAACTTCCTGGGCTTTCCCCAGGCCAGAGAAAGCTGTGTCAG

TTGTATCAGGAGCACATGTCCTACATCGGGGAGGGAGCCAAGACGGGCATCAGAGAGTGCCAACACCAGTTTCGACAGAGGCGCTGGAACTGCAGCACCG

TGGACAACACATCTGTCTTTGGCAGAGTTATGCAGATAG - UNI32469 - GTAGCCGAGAGACTGCCTTCACGTATGCAGTGAGCGCCGCTGGCGTG

GTGAATGCCATCAGCCGAGCCTGCAGAGAGGGTGAGCTGTCCACCTGTGGCTGCAGCCGTGCTGCGAGGCCCAAGGACCTGCCTCGGGACTGGCTGTGGG

GTGGCTGTGGAGACAACGTGGAGTACGGCTACCGCTTTGCCAAGGAGTTTGTGGATGCCCGAGAGCGTGAGAAGAACTTTGCCAAGGGATCGGAGGAGCA

GGGCCGAGCTCTCATGAACCTACAGAACAACGAGGCTGGCCGCCGG GCCGTGTATAAGATGGCTGATGTCGCCTGCAAATGTCACGGAGTCTCCGGGTC

CTGCAGCCTCAAGACCTGCTGGCTCCAGCTGGCCGAGTTCCGCAAGGTGGGGGACCGTTTGAAGGAGAAGTACGACAGCGCCGCGGCCATGCGCATCACC

CGCCAGGGCAAGCTGGAGCTGGCCAACAGCCGCTTCAACCAGCCCACCCCAGAGGACCTGGTCTACGTGGACCCCAGTCCTGACTACTGCCTGCGTAATG

AGACCACAGGCTCCCTGGGCACCCAGGGTCGCCTCTGCAACAAGACCTCAGAGGGCATGGACGGCTGCGAGCTCATGTGCTGTGGCCGCGGCTATGACCG

CTTCAAGAGCGTTCAGGTGGAACGCTGCCACTGCAGGTTCCACTGGTGTTGCTTTGTCAGATGCAAAAAATGCACCGAGGTTGTGGACCAGTATGTCTGT

AAGTGACTGCACCACACGGGCCTTCAGGCCGCTCCTCTCCGCCTCACAAAAGTCTATATTATATAAATCTATCTAAATATATTTTATATTTGTACAAATG

GATGGATGGATGGATGATAGATAATCAAGAGAAGAAAGTGGAGAGGAAGAGCTTAGGAGATGCTGGCCCTCTGTGAGGACTGGATTTTGCTGGAAATCCA

CAACCAGTGGGAGAGAAACGGGCTTTTCCCCATTTTCTGGCCAGGACTTTTGGGACATGGGCTTGAGAGTGTCTGTGCGCCATAGCCTCCAGGAGACAGG

TGGGGATTAGATGAAGGAACTGGACTTATTCCACATCTACAGTCCTGTGGGGAAGATGAGTGTCTGTGACCCTGGCCAGGAGACCCAGAGGCCCTGTGGA

AAGACCTGATAACCGGGATGGTAGCCTAGGTCTTCCTGAAAATGGAGCCAGCTTTGGGAAGGGGCTCTGTACTTCCTTCTTTTCTCATCTGAGTACACAC

TGCAGGAAAGTCCCCTGCCCCAATATGGGGGAGTGGTCTCAAGTCACTCCAACCGGTGACCGTAAGAGATCTGGGCCTCCCTGGACCCTGGCTCTGCCTT

CTGATGAGAATGTCACCAGCTCCTGCCTCAAGCTCTTGTGCCAAGAGAAAGACGGTTCTGTCACCTGCTACAGCCAGGAAGACGTGGAGCAAACCTGGGA

TTTGACTGGGGACCAAGTGCCTGTTGCACAGGACAGGAATCTGCTGTCACTCTGTCAAGGGAGGCTTTGAGAATGACAGGGCATGCTAGCAGGTCAGGTC

AACTGCCTGTGAGACTGTCATCTCTGCCCACATGTACAGCGTCCCTTTGACATTAAATATCTTTTTACTG
Translation
 - UNI31795 - - UNI32469 - MLVPGHWDGLRPAMPSLLLVVVAALLSSWAQLLTDANSWW - UNI32469 - WSLALNPVQRPEMFIIGAQ

PVCSQLPGLSPGQRKLCQLYQEHMSYIGEGAKTGIRECQHQFRQRRWNCSTVDNTSVFGRVMQIG - UNI32469 - GSRETAFTYAVSAAGVVNAIS

RACREGELSTCGCSRAARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRALMNLQNNEAGRR AVYKMADVACKCHGVSGSCSLK

TCWLQLAEFRKVGDRLKEKYDSAAAMRITRQGKLELANSRFNQPTPEDLVYVDPSPDYCLRNETTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDRFKSV

QVERCHCRFHWCCFVRCKKCTEVVDQYVCK
Transcript ENSMUST00000119369
Sequence
GATCGCGCGCCCCGCGCCGGCGCTGCACTCGAGCCGTGGCCGCCAACGGTGCCGCTAAGTCGGGGCCGAAACTTCTCGGGGTCCCGCGCTCCAGGCCGGT

GGCGCTAGCGGCGCCTGAAGGGACGGTGGGGACAACGCGTCTCCCCGGACCCCGAGACCGCGCAGCCTGCGGCCGAGTCGGAGCTCCGGGCGCCCAGCGC

CCATCAGGGCGGACCGGGCACTCCGGGCGGGCAGGCTCCGGCCGCGGATGAGGAGTGCGGGGCGGCTGCGCGAGCGGCCCGCGCGCTGAGCCGAGGCTGC

CCCGTCCCGTGGACGACCCGACGCCGCAGCCCCCGCAG - UNI31795 - - UNI32469 - GGAGCTCCGCTTTGGAAGATGTTGGTCCCAGGGCA

TTGGGATGGGTTGAGGCCGGCCATGCCCAGCCTGCTGCTGGTGGTCGTGGCAGCTCTGCTCTCCAGCTGGGCACAGCTGCTGACTGACGCCAACTCCTGG

TG - UNI32469 - GTCACTAGCTCTGAACCCAGTGCAGAGACCGGAGATGTTCATCATTGGCGCTCAGCCCGTGTGCAGCCAACTTCCTGGGCTTTC

CCCAGGCCAGAGAAAGCTGTGTCAGTTGTATCAGGAGCACATGTCCTACATCGGGGAGGGAGCCAAGACGGGCATCAGAGAGTGCCAACACCAGTTTCGA

CAGAGGCGCTGGAACTGCAGCACCGTGGACAACACATCTGTCTTTGGCAGAGTTATGCAGATAG - UNI32469 - GTAGCCGAGAGACTGCCTTCAC

GTATGCAGTGAGCGCCGCTGGCGTGGTGAATGCCATCAGCCGAGCCTGCAGAGAGGGTGAGCTGTCCACCTGTGGCTGCAGCCGTGCTGCGAGGCCCAAG

GACCTGCCTCGGGACTGGCTGTGGGGTGGCTGTGGAGACAACGTGGAGTACGGCTACCGCTTTGCCAAGGAGTTTGTGGATGCCCGAGAGCGTGAGAAGA

ACTTTGCCAAGGGATCGGAGGAGCAGGGCCGAGCTCTCATGAACCTACAGAACAACGAGGCTGGCCGCCGG GCCGTGTATAAGATGGCTGATGTCGCCT

GCAAATGTCACGGAGTCTCCGGGTCCTGCAGCCTCAAGACCTGCTGGCTCCAGCTGGCCGAGTTCCGCAAGGTGGGGGACCGTTTGAAGGAGAAGTACGA

CAGCGCCGCGGCCATGCGCATCACCCGCCAGGGCAAGCTGGAGCTGGCCAACAGCCGCTTCAACCAGCCCACCCCAGAGGACCTGGTCTACGTGGACCCC

AGTCCTGACTACTGCCTGCGTAATGAGACCACAGGCTCCCTGGGCACCCAGGGTCGCCTCTGCAACAAGACCTCAGAGGGCATGGACGGCTGCGAGCTCA

TGTGCTGTGGCCGCGGCTATGACCGCTTCAAGAGCGTTCAGGTGGAACGCTGCCACTGCAGGTTCCACTGGTGTTGCTTTGTCAGATGCAAAAAATGCAC

CGAGGTTGTGGACCAGTATGTCTGTAAGTGACTGCACCACACGGGCCTTCAGGCCGCTCCTCTCCGCCTCACAAAAGTCTATATTATATAAATCTATCTA

AATATATTTTATATTTGTACAAATGGATGGATGGATGGATGATAGATAATCAAGAGAAGAAAGTGGAGAGGAAGAGCTTAGGAGATGCTGGCCCTCTGTG

AGGACTGGATTTTGCTGGAAATCCACAACCAGTGGGAGAGAAACGGGCTTTTCCCCATTTTCTGGCCAGGACTTTTGGGACATGGGCTTGAGAGTGTCTG

TGCGCCATAGCCTCCAGGAGACAGGTGGGGATTAGATGAAGGAACTGGACTTATTCCACATCTACAGTCCTGTGGGGAAGATGAGTGTCTGTGACCCTGG

CCAGGAGACCCAGAGGCCCTGTGGAAAGACCTGATAACCGGGATGGTAGCCTAGGTCTTCCTGAAAATGGAGCCAGCTTTGGGAAGGGGCTCTGTACTTC

CTTCTTTTCTCATCTGAGTACACACTGCAGGAAAGTCCCCTGCCCCAATATGGGGGAGTGGTCTCAAGTCACTCCAACCGGTGACCGTAAGAGATCTGGG

CCTCCCTGGACCCTGGCTCTGCCTTCTGATGAGAATGTCACCAGCTCCTGCCTCAAGCTCTTGTGCCAAGAGAAAGACGGTTCTGTCACCTGCTACAGCC

AGGAAGACGTGGAGCAAACCTGGGATTTGACTGGGGACCAAGTGCCTGTTGCACAGGACAGGAATCTGCTGTCACTCTGTCAAGGGAGGCTTTGAGAATG

ACAGGGCATGCTAGCAGGTCAGGTCAACTGCCTGTGAGACTGTCATCTCTGCCCACATGTACAGCGTCCCTTTGACATTAAATATCTTTTTACTG
Translation
 - UNI31795 - - UNI32469 - MLVPGHWDGLRPAMPSLLLVVVAALLSSWAQLLTDANSWW - UNI32469 - WSLALNPVQRPEMFIIGAQ

PVCSQLPGLSPGQRKLCQLYQEHMSYIGEGAKTGIRECQHQFRQRRWNCSTVDNTSVFGRVMQIG - UNI32469 - GSRETAFTYAVSAAGVVNAIS

RACREGELSTCGCSRAARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRALMNLQNNEAGRR AVYKMADVACKCHGVSGSCSLK

TCWLQLAEFRKVGDRLKEKYDSAAAMRITRQGKLELANSRFNQPTPEDLVYVDPSPDYCLRNETTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDRFKSV

QVERCHCRFHWCCFVRCKKCTEVVDQYVCK
Transcript ENSMUST00000117171
Sequence
GAAAACCAAAAGGACTGGGGAACAGGCCTGTCCCAACTCTGAATCCTGCTCCGGCCACCTTTCTCTCTTAGTGGCCCCAGGTTAAACATATTTCCTAGAC

CAACGGTCTAAAAAGCATCTGCCGCCCCCTCCCGGACAGTCTAGAGACCCAGACGCTCGGGATCAGCGTG - UNI31795 - - UNI32469 - GGA

GCTCCGCTTTGGAAGATGTTGGTCCCAGGGCATTGGGATGGGTTGAGGCCGGCCATGCCCAGCCTGCTGCTGGTGGTCGTGGCAGCTCTGCTCTCCAGCT

GGGCACAGCTGCTGACTGACGCCAACTCCTGGTG - UNI32469 - GTCACTAGCTCTGAACCCAGTGCAGAGACCGGAGATGTTCATCATTGGCGCT

CAGCCCGTGTGCAGCCAACTTCCTGGGCTTTCCCCAGGCCAGAGAAAGCTGTGTCAGTTGTATCAGGAGCACATGTCCTACATCGGGGAGGGAGCCAAGA

CGGGCATCAGAGAGTGCCAACACCAGTTTCGACAGAGGCGCTGGAACTGCAGCACCGTGGACAACACATCTGTCTTTGGCAGAGTTATGCAGATAG - U

NI32469 - GTAGCCGAGAGACTGCCTTCACGTATGCAGTGAGCGCCGCTGGCGTGGTGAATGCCATCAGCCGAGCCTGCAGAGAGGGTGAGCTGTCCA

CCTGTGGCTGCAGCCGTGCTGCGAGGCCCAAGGACCTGCCTCGGGACTGGCTGTGGGGTGGCTGTGGAGACAACGTGGAGTACGGCTACCGCTTTGCCAA

GGAGTTTGTGGATGCCCGAGAGCGTGAGAAGAACTTTGCCAAGGGATCGGAGGAGCAGGGCCGAGCTCTCATGAACCTACAGAACAACGAGGCTGGCCGC

CGG GCCGTGTATAAGATGGCTGATGTCGCCTGCAAATGTCACGGAGTCTCCGGGTCCTGCAGCCTCAAGACCTGCTGGCTCCAGCTGGCCGAGTTCCGC

AAGGTGGGGGACCGTTTGAAGGAGAAGTACGACAGCGCCGCGGCCATGCGCATCACCCGCCAGGGCAAGCTGGAGCTGGCCAACAGCCGCTTCAACCAGC

CCACCCCAGAGGACCTGGTCTACGTGGACCCCAGTCCTGACTACTGCCTGCGTAATGAGACCACAGGCTCCCTGGGCACCCAGGGTCGCCTCTGCAACAA

GACCTCAGAGGGCATGGACGGCTGCGAGCTCATGTGCTGTGGCCGCGGCTATGACCGCTTCAAGAGCGTTCAGGTGGAACGCTGCCACTGCAGGTTCCAC

TGGTGTTGCTTTGTCAGATGCAAAAAATGCACCGAGGTTGTGGACCAGTATGTCTGTAAGTGACTGCACCACACGGGCCTTCAGGCCGCTCCTCTCCGCC

TCACAAAAGTCTATATTATATAAATCTATCTAAATATATTTTATATTTGTACAAATGGATGGATGGATGGATGATAGATAATCAAGAGAAGAAAGTGGAG

AGGAAGAGCTTAGGAGATGCTGGCCCTCTGTGAGGACTGGATTTTGCTGGAAATCCACAACCAGTGGGAGAGAAACGGGCTTTTCCCCATTTTCTGGCCA

GGACTTTTGGGACATGGGCTTGAGAGTGTCTGTGCGCCATAGCCTCCAGGAGACAGGTGGGGATTAGATGAAGGAACTGGACTTATTCCACATCTACAGT

CCTGTGGGGAAGATGAGTGTCTGTGACCCTGGCCAGGAGACCCAGAGGCCCTGTGGAAAGACCTGATAACCGGGATGGTAGCCTAGGTCTTCCTGAAAAT

GGAGCCAGCTTTGGGAAGGGGCTCTGTACTTCCTTCTTTTCTCATCTGAGTACACACTGCAGGAAAGTCCCCTGCCCCAATATGGGGGAGTGGTCTCAAG

TCACTCCAACCGGTGACCGTAAGAGATCTGGGCCTCCCTGGACCCTGGCTCTGCCTTCTGATGAGAATGTCACCAGCTCCTGCCTCAAGCTCTTGTGCCA

AGAGAAAGACGGTTCTGTCACCTGCTACAGCCAGGAAGACGTGGAGCAAACCTGGGATTTGACTGGGGACCAAGTGCCTGTTGCACAGGACAGGAATCTG

CTGTCACTCTGTCAAGGGAGGCTTTGAGAATGACAGGGCATGCTAGCAGGTCAGGTCAACTGCCTGTGAGACTGTCATCTCTGCCCACATGTACAGCGTC

CCTTTGACATTAAATATCTTTTTACTGAGG
Translation
 - UNI31795 - - UNI32469 - MPSLLLVVVAALLSSWAQLLTDANSWW - UNI32469 - WSLALNPVQRPEMFIIGAQPVCSQLPGLSPGQ

RKLCQLYQEHMSYIGEGAKTGIRECQHQFRQRRWNCSTVDNTSVFGRVMQIG - UNI32469 - GSRETAFTYAVSAAGVVNAISRACREGELSTCGC

SRAARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRALMNLQNNEAGRR AVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKVG

DRLKEKYDSAAAMRITRQGKLELANSRFNQPTPEDLVYVDPSPDYCLRNETTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDRFKSVQVERCHCRFHWCC

FVRCKKCTEVVDQYVCK
Transcript ENSMUST00000118120
Sequence
CCTTGCTGCTTCTCATTCCATGAGCTGGGGAGAGACAGTGTGGAAGTCAAACCATGTCTTTCTTGAGAGCAGGTGCTGCTGGGGTTCCCTGAATGGCGGC

TAGGTGCCAAGAG - UNI31795 - - UNI32469 - GGAGCTCCGCTTTGGAAGATGTTGGTCCCAGGGCATTGGGATGGGTTGAGGCCGGCCATG

CCCAGCCTGCTGCTGGTGGTCGTGGCAGCTCTGCTCTCCAGCTGGGCACAGCTGCTGACTGACGCCAACTCCTGGTG - UNI32469 - GTCACTAGC

TCTGAACCCAGTGCAGAGACCGGAGATGTTCATCATTGGCGCTCAGCCCGTGTGCAGCCAACTTCCTGGGCTTTCCCCAGGCCAGAGAAAGCTGTGTCAG

TTGTATCAGGAGCACATGTCCTACATCGGGGAGGGAGCCAAGACGGGCATCAGAGAGTGCCAACACCAGTTTCGACAGAGGCGCTGGAACTGCAGCACCG

TGGACAACACATCTGTCTTTGGCAGAGTTATGCAGATAG - UNI32469 - GTAGCCGAGAGACTGCCTTCACGTATGCAGTGAGCGCCGCTGGCGTG

GTGAATGCCATCAGCCGAGCCTGCAGAGAGGGTGAGCTGTCCACCTGTGGCTGCAGCCGTGCTGCGAGGCCCAAGGACCTGCCTCGGGACTGGCTGTGGG

GTGGCTGTGGAGACAACGTGGAGTACGGCTACCGCTTTGCCAAGGAGTTTGTGGATGCCCGAGAGCGTGAGAAGAACTTTGCCAAGGGATCGGAGGAGCA

GGGCCGAGCTCTCATGAACCTACAGAACAACGAGGCTGGCCGCCGG GCCGTGTATAAGATGGCTGATGTCGCCTGCAAATGTCACGGAGTCTCCGGGTC

CTGCAGCCTCAAGACCTGCTGGCTCCAGCTGGCCGAGTTCCGCAAGGTGGGGGACCGTTTGAAGGAGAAGTACGACAGCGCCGCGGCCATGCGCATCACC

CGCCAGGGCAAGCTGGAGCTGGCCAACAGCCGCTTCAACCAGCCCACCCCAGAGGACCTGGTCTACGTGGACCCCAGTCCTGACTACTGCCTGCGTAATG

AGACCACAGGCTCCCTGGGCACCCAGGGTCGCCTCTGCAACAAGACCTCAGAGGGCATGGACGGCTGCGAGCTCATGTGCTGTGGCCGCGGCTATGACCG

CTTCAAGAGCGTTCAGGTGGAACGCTGCCACTGCAGGTTCCACTGGTGTTGCTTTGTCAGATGCAAAAAATGCACCGAGGTTGTGGACCAGTATGTCTGT

AAGTGACTGCACCACACGGGCCTTCAGGCCGCTCCTCTCCGCCTCACAAAAGTCTATATTATATAAATCTATCTAAATATATTTTATATTTGTACAAATG

GATGGATGGATGGATGATAGATAATCAAGAGAAGAAAGTGGAGAGGAAGAGCTTAGGAGATGCTGGCCCTCTGTGAGGACTGGATTTTGCTGGAAATCCA

CAACCAGTGGGAGAGAAACGGGCTTTTCCCCATTTTCTGGCCAGGACTTTTGGGACATGGGCTTGAGAGTGTCTGTGCGCCATAGCCTCCAGGAGACAGG

TGGGGATTAGATGAAGGAACTGGACTTATTCCACATCTACAGTCCTGTGGGGAAGATGAGTGTCTGTGACCCTGGCCAGGAGACCCAGAGGCCCTGTGGA

AAGACCTGATAACCGGGATGGTAGCCTAGGTCTTCCTGAAAATGGAGCCAGCTTTGGGAAGGGGCTCTGTACTTCCTTCTTTTCTCATCTGAGTACACAC

TGCAGGAAAGTCCCCTGCCCCAATATGGGGGAGTGGTCTCAAGTCACTCCAACCGGTGACCGTAAGAGATCTGGGCCTCCCTGGACCCTGGCTCTGCCTT

CTGATGAGAATGTCACCAGCTCCTGCCTCAAGCTCTTGTGCCAAGAGAAAGACGGTTCTGTCACCTGCTACAGCCAGGAAGACGTGGAGCAAACCTGGGA

TTTGACTGGGGACCAAGTGCCTGTTGCACAGGACAGGAATCTGCTGTCACTCTGTCAAGGGAGGCTTTGAGAATGACAGGGCATGCTAGCAGGTCAGGTC

AACTGCCTGTGAGACTGTCATCTCTGCCCACATGTACAGCGTCCCTTTGACATTAAATATCTTTTTACTGA
Translation
 - UNI31795 - - UNI32469 -  - UNI32469 - MFIIGAQPVCSQLPGLSPGQRKLCQLYQEHMSYIGEGAKTGIRECQHQFRQRRWNCSTV

DNTSVFGRVMQIG - UNI32469 - GSRETAFTYAVSAAGVVNAISRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDARERE

KNFAKGSEEQGRALMNLQNNEAGRR AVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKVGDRLKEKYDSAAAMRITRQGKLELANSRFNQPTPEDLVYV

DPSPDYCLRNETTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDRFKSVQVERCHCRFHWCCFVRCKKCTEVVDQYVCK

For any suggestions or comments, please send an email to unitrap@crg.es