Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030180 (Jarid1a)
Chromosomal location
Chr 6: 120314137 - 120394592 (+)
Description
jumonji, AT rich interactive domain 1A (Rbp2 like) Gene [Source:MGI Symbol;Acc:MGI:2136980]
UniGene
Mm.472769 
MGI
MGI:2136980 
Uniprot/SWISSPROT
Q3UXZ9 
Uniprot/SPTREMBL
Q3U4V8 Q3UZ11 Q3V3E9 Q921T5 
Human Ortholog
ENSG00000073614 (JARID1A)
Omim not available
UniTrap UNI4928
Vector Insertion
Chr 6: 120314141 - 120314797
Public Clones AE0666 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23251
Vector Insertion
Chr 6: 120316666 - 120318949
Public Clones not available
Private Clones OST269298 (lexicon) OST230192 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2846
Vector Insertion
Chr 6: 120319073 - 120324834
Public Clones AD0179 (sanger) AF0582 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4379
Vector Insertion
Chr 6: 120325006 - 120331552
Public Clones AE0710 (sanger) AE0722 (sanger) RRI017 (baygenomics) RRI020 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3889
Vector Insertion
Chr 6: 120335732 - 120338027
Public Clones AW0113 (sanger) RRI154 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7382
Vector Insertion
Chr 6: 120344268 - 120348955
Public Clones RRR210 (baygenomics) RRS424 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35985
Vector Insertion
Chr 6: 120356003 - 120356592
Public Clones IST14780A2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000005108
Sequence
GGAAGCGCGCGTTCCACCTTGCGGGGTAGCTTTTCCCTCGCCTCTCCTCGAGAGAGGTCGCGGCGCCTTGAGGGGCCGCGCACCCGGGGTGGACGGAGGG

CGCAGAACTTTGACAGGCAAGCTGTGAGAAAACAAAAAACCAAAATAAAACAAAAAAGCTCCGCCGGCCGTCATGGAAGGGAGCGAGGAGAGAAGACCCG

ACTAGACGTGGCGGCGGTGGGATTTTGTTTCCTGCGGTGGCGGACTGATTTAGCAGCACGTTAACTTCCGGGAGCGTCCTGCCCCTGAGAGGAAAAGCCC

TGAAGGAAACAATAACAAACGAGCGGAGGGAGAGCGGCTGGCGCTCCTGTGAGGACTCGTTCTCGTCCTAAGAAGATGCGCTGCGGCCCCAGTGCGGGGA

CGTGAGAGGGCTTTGGTGGCCGTCAGCCAAGCCTTTCCTCGCTTGTGCACCTCAGGCCCCCCTGGCTTTTTATTTTATTTTTTGGTGACCATGGCGTCCG

TGGGCCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCCGAGTGCCCGGTCTTTGAGCCCAGTTGGGAGGAGTTCACAGACCCGCTGAGTTTTATCGG

GCGCATCCGGCCCTTTGCGGAGAAAACGGGCATCTGCAAAATCCGGCCACCCAAG - UNI4928 - GATTGGCAACCTCCATTTGCCTGTGAAGTAAA

AACCTTCCGTTTCACTCCTAGAGTCCAGCGCCTGAATGAACTTGAG - UNI23251 - GCAATGACTAGAGTAAGATTGGACTTCTTGGATCAACTGG

CAAAATTTTGGGAACTTCAAGGATCTACATTGAAGATCCCTGTGGTGGAGAGAAAAATCCTGGATTTGTATGCTTTAAGCAAG - UNI2846 - ATTG

TTGCCAGCAAAGGAGGTTTTGAAATAGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGCCGCTTGGGATATCTGCCAGGAAAAGGAACTGGGTCTCT

TTTGAAGTCACACTATGAAAGAATTCTCTACCCATATGAACTTTTCCAATCTGGTGTCAGCCTTATG - UNI4379 - GGTGTACAAATGCCTGATTT

AGATCTTAAAGAAAAAGTTGAGGCTGAGGTTCTCAGCACTGACATCCAGCCTTCCCCAGAGCGGGGAACAAGAATGAATATTCCACCAAAGAGAACAAGA

CGAGTTAAGTCTCAG TCAGACTCTGGAGAAGTAAATAGAAACACAGAACTGAAGAAACTTCAGATTTTTGGGGCTGGACCCAAAGTTGTGGGCCTGGCA

GTAGGAGCAAAAGATAAAGAAG ATGAAGTCACCCGAAGAAGAAAAGTTACCAACAGGTCAGATGCATTTAACATGCAAATGAGACAACGGAAAGGAACT

CTCTCTGTTAACTTT - UNI3889 - GTTGATCTCTATGTTTGCATGTTTTGTGGTCGAGGAAATAATGAGGATAAACTGCTTTTGTGTGATGGGTGC

GATGACAGCTATCATACATTTTGTCTACTTCCACCACTACCTGATGTCCCCAAAGGAGACTGGAGGTGTCCTAAATGTGTTGCTGAG GAATGTAACAAA

CCTCGAGAAGCCTTTGGATTTGAGCAAGCTGTAAGAGAATATACACTTCAAAGCTTTGGAGAGATGGCAGATAATTTTAAATCTGATTATTTCAATATGC

CAGTCCAT ATGGTTCCTACAGAGCTAGTAGAAAAAGAATTCTGGCGGCTAGTAAGTAGCATTGAAGAAGATGTTATTGTAGAGTATGGAGCTGATATCT

CTTCAAAAGATTTTGGAAGTGGATTTCCTAAAAAGGATGGTCAAAGAAAGATGTTGCCAGAAGAAGAG GAATATGCACTTTCTGGTTGGAATTTGAATA

ACATGCCTGTTCTGGAGCAGTCCGTTCTTGCACATATTAATGTGGACATTTCTGGTATGAAGGTGCCATGGCTCTATGTGGGAATGTGCTTTTCTTCTTT

TTGCTGGCATATTGAAGATCACTGGAGTTATTCCATTAACTACTTGCATTG GGGCGAGCCAAAGACATGGTATGGTGTACCATCTCATGCTGCAGAACA

ACTGGAGGAGGTGATGAGGGAGCTGGCCCCTGAGTTATTTGAATCCCAGCCTGATCTCCTACATCAGTTAGTAACCATCATGAACCCAAATGTGCTCATG

GAGCATGGTGTGCCT - UNI7382 - GTGTACAGGACTAATCAGTGTGCTGGAGAGTTTGTGGTGACGTTTCCTCGTGCCTATCACTCTGGATTTAAC

CAGGGATACAACTTTGCCGAAGCGGTGAACTTCTGTACTGCTGACTGG TTGCCCATTGGACGTCAGTGTGTAAATCACTATCGACGGCTCAGGCGCCAT

TGTGTCTTTTCACATGAGGAACTCATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTGGGGCTGGCTGCCATGGTATGCAAAGAGTTGACTCTCA

TGACTGAAGAAGAAACACGATTGAGAGAATCAGTTGTTCAAATG GGTGTCGTGATGTCAGAAGAAGAAGTCTTTGAACTTGTTCCTGATGATGAGCGGC

AGTGTTCAGCATGCAGAACTACATGTTTTCTCTCAGCTCTCACATGCTCCTGTAATCCGGAGCGACTTGTATGTCTGTATCATCCAACTGATTTGTGCTC

TTGCCCCATGCAGAACAAATGTCTTAG GTACCGCTATCCACTAGAAGACCTTCCATCTCTGCTTTATGGTGTCAAAGTGAGAGCACAATCCTATGACAC

TTGGGTCAATCGTGTTACAGAAGCATTGTCAGCTAGCTTCAACCATAAGAAAG - UNI35985 - ATTTGATTGAATTGAGAGTAATGCTGGAAGATG

CTGAGGATAGGAAATACCCAGAGAATGATCTCTTTCGAAAGCTCAGGGACGCGGTGAAAGAAGCTGAGACCTGTGGTTCTGTGGCTCAGCTGCTTCTGAG

CAAAAAGCAAAAACACAG GCAGAGCTCAGATAGTGGGAAGACTCGGACCAAACTGACAGTAGAAGAATTGAAGGCCTTTGTCCAACAACTTGTTAGTCT

TCCGTGTGTCATCAGCCAAACTCGACAAGTAAAG AATCTGCTGGATGATGTAGAAGAATTTCATGAACGTGCCCAGGAGGCCATGATGGATGAAACCCC

AGATTCTTCCAAACTCCAAATGTTAATAGACATGGGCTCTAGTCTCTATGTGGAGCTACCTGAATTGCCCCGACTAAAGCAAGAGCTCCAGCAGGCTCGA

TGGCTGGATGAAGTAAGGCTAACTCTATCAGATCCACAACAAGTCACTTTGGATGTCATGAAGAAATTGATTGACTCTGGCGTAGGCTTGGCACCTCACC

ATGCTGTAGAAAAAGCAATGGCCGAACTACAGGAACTCCTTACAGTCTCTGAACGATGGGAAGAGAAGGCTAAGGTCTGCCTGCAAGCAAG ACCTCGGC

ACAGTATGGCAAATTTAGAAAATATTGTGAATGAAGCCAAGAACATTCCAGCCTTTCTACCCAATGTGTTGTCCTTAAAAGAAGCCTTACAAAAGGCTCG

TGAATGGACAGCTAAAGTGGAAGCTATTCAG AGTGGCAACAACTATGCTTACTTGGAACAGCTTGAGAGCCTATCTGCTAAAGGACGCCCTATCCCTGT

GCGTCTTGATGCCTTGCCTCAAGTGGAGTCACAGGTAGCAGCAGCACGGGCCTGGAGAGAACGTACTGGGCGGACCTTCCTTAAAAAGAATTCCAGCCAT

ACATTGTTACAG GTGCTAAGTCCACGAACTGACATTGGTGTATATGGGAGTGGTAAAAACAGGAGGAAAAAGGTAAAAGAAATAATAGAAAAAGAAAAG

GAGAAGGACCTCGACCTTGAGCCTTTGAGTGACTTAGAGGAAGGACTGGAGGAGTCAAGAGATACAGCCATGGTG GTGGCAGTTTTCAAAGAACGAGAG

CAAAAGGAGATTGAAGCCATGCATTCCCTCAGAGCAGCCAACCTAGCCAAGATGACAATTGTGGAGCGCATAGAAGAAGTGAAATTTTGTATTTGCCGCA

AGACAGCCAGTGGGTTTATGCTACAGTGTGAGCTCTGCAAAGACTGGTTCCATAACAGCTGTGTTCCCCTTCCTAAATCAAGTTCCCAGAAAAAGGGATC

CAGCTGGCAGGCTAAAGATGTAAAATTCCTTTGCCCTCTTTGCATGAGATCTCGGAGGCCAAGGCTAGAGACTATTCTGTCACTCCTGGTATCCCTTCAG

AAGTTGCCTGTACGGTTGCCGGAAGGAGAAGCACTGCAGTGTTTGACAGAACGTGCCATGAGTTGGCAAGATAAAGCACGCCAAGCTTTAGCCACAGATG

AACTGTCCTCTGCCCTGGCCAAGCTCTCTGTGCTAAGCCAGCGTATGGTGGAACAAGCAGCTAGAGAAAAAACTGAAAAGATTATCAGTGCAGAACTCCA

AAAAGCAGCTGCCAATCCAGATTTACAG GGACACTTACCTAGTTTCCAGCAGTCTGCTTTTAACCGGGTGGTGAGCAGTGTATCATCTTCCCCCCACCA

AACAATGGACTATGATGATGAAGAAACAGATTCTGATGAAGATATTCGGGAGACATACGGCTATGACATGAAG GATACAGCCAGCGTGAAGTCCTCTAG

TAGTCTGGAACCCAATCTCTTTTGTGATGAAGAGATTCCCATCAAGTCTGAGGAAGTGGTGACTCACATGTGGACGGCACCGTCATTCTGTGCAGAGCAT

GCATATTCTTCTGCTTCAAAGAGTTGTTCTCAAG GTTCTAGCACTCCAAGAAAGCAGCCTCGGAAGAGCCCTTTGGTTCCCAGAAGTTTGGAGCCTCCA

GTATTGGAATTGTCTCCTGGAGCAAAAGCCCAGTTGGAAGAACTCATGATGGTTGGAGACCTCCTAGAAGTGTCTCTGGATGAGACACAACACATTTGGC

GGATTTTGCAGGCCACACATCCACCCTCAGAGGACAGATTCTTACATATCATGGAG GATGATAGCATAGAAGAGAAACCATTAAAAATGAAAGGAAAGG

ACTCTTCAGAGAAGAAACGGAAACGGAAGCTAGAAAAGGTAGAACAGCTTTTTGGAGAAGGAAAACAGAAGACCAAGGAGCTAAAGAAAATAGATAAACC

TAAAAAGAAGAAATTAAAATTAAATGTGGACAAATCAAAAGAGCTGAATAAATTGGCCAAGAAGTTAGCTAAAGAAGAAGAGCGAAAGAAAAAGAAAGAA

AAGGCTGCTGCCGCCAAAGTGGAGCTTGTGAAAGAGAGCACGGAGAAGAAACGGGAGAGGAAGGTGTTGGATATCCCCTCAAAGTATGACTGGTCGGGGG

CAGAGGAGTCTGATGATGAGAATGCTGTGTGTGCAGCCCAAAACTGCCAAAGGCCGTGTAAGGACAAG AGGTAGACTGGGTACAGTGTGATGGTGGCTG

TGATGAGTGGTTTCATCAAGTTTGTGTTGGTGTATCCGCAGAAATGGCTGAAAATGAAGATTACATCTGTATAAACTGTGCAAAGAAGCAGGGGCCAGAT

AGCCCAGGCCAAGCACCACCTCCTCCCTTCCTAATGAGCTACAAACTACCAATGGAGGATCTTAAAGAGACCAGTTAGCAGATGTCTGGTTAGCTTGCAA

CATGGGGGGAAGTGGACCACATTGAGACCTTACTCATCAAGCAGAGTGGTTCCGACCACTCAGAATGTTGTTTCCAAAGATGAATGGACTTCAGAAAAAG

TCCTCTTAGTGCTGGCTTCCTCTCTGCATGGATTGTGTGGGCTCCATTCTCTTATCATCTGTGCAGAGGATGTCTTCTTTGGTGCAGCAGCCAAGTATTT

CAACTCTTGATTCGTTGAGTGTGGTTTGCTGAATTAAGGTCAGGTTCTAATGGAACTCTCAGGAGGCTGTTTGGCATTAATACATTGATGTGCTTAGTGG

GGCATATAAGAAGTGGCTTTCGACCAACTGATACTTGTTGTAGACGGTTACAACCTACAGGTGGTGCCATTGGAAGGCCCTGACCGTTTAAATATCCTTA

GTTAGGATAATTGGACAGGAGTCAGAGCACAACTTTGTAATTACTGACATTTATGCCCTACTGATCCAGTTAAGAGAAGCAGGCCAAAGTTATCCCTTCT

AGAAGTCTTGGAGTGGCAGTGCAGTCTATGACCTCAGCTGCTTGTGTTTATTTAGACCAATAAGAAAATCCTCCAAAAGATCCCCTCACTTTCCTCAGGA

GGATGTCAAGCAGGTTAGAATATCTGATTAGACTGGATTCTGGGAAGAAGGGGTTTTTTTTTTGTTTGTTTGTTTGGTTTGGTTTGGTTTTTTCTTACTT

CAAGGCAAGTAGGCCATTGGTTTGAGAAGTCCATCTGGGTCTGTGTTTTAGAAAAGAAAGGTAGGTACACAGATCCAGGTTTCTGGAGGGAGTAGGGATG

ACTAATGAGAATGTTTTACTGAGCCTCGGTGATGCATGCTTATCTGGGAAACCCTCATTCACAAGTATTCCAGACTCCACCATGCTTCACGCATGGCCAT

GAGCAAGACTGGCAGATAACAGCTTTTGCCTTGCAGCCCTAACCCCAATGCCTGTAGTTTCCAACATGGCCTCAGCAGATATTTGTGAATAACACCATGG

CTTCATCAGAGGATGTGGGGCTGTAGGTCCTCTGGGTGTGAAGCTGTTCTAGTAAACCCATTTTTAAAAAGAAAGACTTGTTTTTACTTTTTTCTAAATG

TCTCTGACTACTGACTGTTCTATAGATTATTTTTCCTTTTTTGATATACATATATGAATATAGATATATATATATATATTTACTGTTACCAGCAGCGTAT

GATAGAGTTTGAGCATCAGAAATCCATTTGGAAGCTTGCATTTTCTTTCTGCTTTTTGATAAAGAAATCCCATTCCTTCCTTGTAGTACAAGGAGTTAGC

ACTTCCTTCTTCATTCTCACCTAAACATATCTTCCACTTTTCTTCTATTCAAATAGATAATATATTTCCTCCATGTTGGGACTTGTCCCTGTCTGTTGGG

CAGCTTGGTCTTATTCTAGTCAGTGCTGAATGTTTTGTATGTCTGAAACTATGGTGCTGTGCCCCCCCCCCCTGCCCCTATTGGGTTCTGTGTTCTTACA

AAGGTCTTAGGTGGACTCTGTAAACTCCTGCTAGAAGGAGAATAATATATTTTAAAGGACAAAAAGGTTTTCTAAAAATGGTGTTTATCTTCACTATCCT

TTGTTCTTTATTTTGGTTTAAGAATCTGCAATTTAACTTAAACTCATCACTTGTCCTGTTAAAGGGGCATTGAGCAAACCTAGGAAGTTTGTAGCCTCTG

TTCCCCTTTACTCCAGTCTCTTAAATAAATGTCTTCTAGTAACTAGAAGTGAGATGTACTGTCCAGTTACAGACTGTGTGGGTATGAGGGCTACCTCAAA

AGGCATCTTAGGAAAAGAAAAGGTTTTCTTACAAAACCCTTTATCCCAAGTGCTAACCAGGCTTGGCCCTGCTTAGCTTCCAAGGTCAGAGGAGACATAC

ACGTGCAGGTGGTACGGCTATAGGTACAACATCCAATTTCTGAAAATACTTTCTCTGGTTTATACTACCTACTTTTTGGTCTCTTCACTTAATGTTAAGT

AACATATCTTGACCAGTTATGTTGTTTGAATGTGTTGCTGTGCTTGTATCTTGAATTTCCATCTCAATGTGAGTGTGAGCTAAGATTTCAGTAATGGTTA

CAAGGTTAATTAAGTAAATAGTTAATTTCACACATTTTCATTTTGCCAAACATGAAGATTATCACGTAAGAATTTTATTTGGTTATTGTTATAATGAAAA

AAAGCACAATATTTCTTAACTTTTAGTCTTTGTAAAAGACTTGAGATACTTGTGGTTTAAAATTGAGTGTACACCAACCCTTCAGAAATTTACAATGTAA

GTGATAGAATCCCAGAATACATTTTACAATTTTGATTTTCCTTCCAGTTAACTACTTTTCATTAACTGTGTTATCAATAGTAAGGAGTCATGAGGATACT

GAAAGGTGACTGTTTTGAGTAATTTGTGTTCTTTGTACAGTGTTTGTCTGTTGGAGACCTCAGACATAGGCAGTCTGTACCTGTGAATAGCTGCCTGTCA

TCTTCTGATGTTTTGAAACTTTTAAATATATAATTTAATTGATTCATTCGGCTCTTCTGTACTTATTTGAAGACTTTGATATCTTAACCATAGATTTAGA

CAAAAACTCAAAAGACCATAAGGGAGGGGGTGGAAAGATGACTCAACGGTTAAGAATCCTGGCTGCTCTTCCAGAGGACCCAGGTTCAGTTCTCAGCACT

ACATGGTGGCTCACAGCCATCTGTAATGTCCTCTTCTGGACGTTACTGCACTGTACACATGTGGCATACAGACATCTATTCTGGAAAATACTCAAAACAC

AAATACAAGTAATTAAAATCTTTTTTTAAAAAATTAAGGATATAAGAGAAACTAGCACTCTACCCACAAATTAAAAACCCTATAGTTTGTGAGTTAATGA

AATAAAGAGTCATCTATTTAAGGAAAAGTAGATGTTCTAATGTAAAGCTTTGTTTCACAAGAATTGCAAGTAACTCCATTCTTCTGTACTGTTTGTTTAC

ATTTTGTATTAAAACTTGATTTATGTTTCTTTCTGACTCCTCAAAGTTGCACTTCTTCGTTATTAAGTGTTTAATATTTTTTAAGCTATTTCTCACTGCC

TTCATTATACTTTAACAAAGGTAACGGAATGAAAAAAGTTGGAAGTCTGCCTGGTGTTTTGGCACACACACTAAGTCCTAGCACTTGGGAGTCAGAGGCA

GAAGATTTAAGTCCAGTGAGTTCTACACTAGCCAGGGCTACATAATAAGAAAGAAAAGAAAAGGTAGTAGGTCATTTAGAACTCTACAGAAATACAAGGT

AGCAGTCGTTACAGGTCCCTAGTTGTTGGAGAAGAGGCAGATGTTTGTTTCACCTCCTGTTATTGCTGCAGAAACCATGAGCAGTGGCTGCTGTGAACCA

GCTCTGCCTGGCTGACTCTGACTTGAGCCGCAGTGAGATTATGAATTACAGTGTGGCATACTTAGAAGAACTGGGAGGCAAACATTCAATCTGTGATTGC

CCATGACCTGAGGAACATGGCAGACACTGCCAGATCTGAGAGATGGATGTGATTTCACAAGTCCTTCCCTTCCTTTCCAGCTCCGCCTTTGGTCCTCAAC

AGGGTCCAAGAAATGTCAATTTGTTTTTCTTAGTTTGCTGGACACAGTTCAGTGAATATAAAGAAACTGCTTGTCAGCTGGGCATGGTAGTATATACTTA

ATCCTGGCACTCGGGAGACATAGGCAGATTGGTCTATATAGTGTGTTCTAAGACAGCCAGAGCTGCATAATAGAACTTGTCACCAAAAAAAAAAAAAAAA

AAGGAAAAGAAACTGCCTGTCAGCCATTAAAATAGAAATAATGGAAAAATAAAGCCTGCCTTTTGCCAAGCAGTTATGAAGCACACCTTTATTTCCAGCA

CTCAGGAGCCAGAGGCAGGAGGATCTTTCTTGAGTTCGAGGCCTGTCTGGTATACAGAACTTGTTCAAGAGCAGCCAAAGCTACAGAGAGACCCTGCCTT

TCAAAAGGTTACATCAGAATACTTTTGGGAGAAAGTAACAATTTGGAGTGGGTTTTGAAAATTGCAAGGTGTAAAGATTTTAAGTTGTTTAAGTCCCAAA

TAACCCTAAACCAAGTCCAATGAAGTTTCATTTATGAAGTTTCAAATGTGAATTCGCTTTATGTGTGTAGAATGTTGCTTTTAGCGTAGGTCCTTGAGCA

CAGTACCTTTCAGACATCCTGTCCCTTTAAATCAAACCACACCGTTACTTTGAATATGGATTTACTACGTGGTATTTATAGCACAAGAGGGAAAGAATGG

ACTTTGATGTCTGAGACTGGAGTATTCTCTTGGCCGGGATCCACTCACCGCTGTGCGGCATAGGATGTGCACCGGGAAGGGACACAACATCTTATACAAT

GATATGTCTGTCTAAACAGGAATATATTTTAAGAACTTGAACCTCCCCCGGTTGATGATTCCCTTACATGTTCATTAAATTTTACCAGGGTTTTTGGTTG

TGTGTAAGAGTAACTTTTAGTCGTCTGGCTTAATTGTTCTCAGGCTTACTGCCTCCCTCTGCTAACCTAAGCTTAGAATATATTCACCTCCGAGACTTTG

TGCTTGCCCTTTCTAGCTCTTTGTGAACTCTGGCTTTACTCTCTGCTCTGCTTGAATTGCTCTGCTAACTCTAGCAATCTGTTCCAAACTTCTGGCTCCT

TTTCATTCTCTGGCTCATTCTGTCTTCACCTGTCTCTGTAAAATTAACTCTCCCAGTAAACTGCCTCTGAATTCCACGAACTCAGCTCCACTGCCTGCCT

TTGAACTGACTCAACCGAAATGACTAAAGAGAACTAACTAGCACTGAGAAATCTGCATGCCTCTCTCTCCTGAGGGCTGGGATTAAGAGTGTGTACCCCC

ACGTCTGGACTTGAGCTTCTTGTTACCTGAAGTTTGCTGTGTACCAGGCTGGCCTTGAATCCAGAGATCTGTTTGTCTATGTCTCTGGGATTAAAGGCAT

GTCTGTATTCCAGCCAGATCACAGAGACCTAGAAGGTCTTTGGATGTGATCTCTTGGCAGAGCAGCCATGTTCTGAATTAAAATTACTCCACAGTTGTGC

CTTACAGAAATTGTAACTTGATTTCATGATGTTTGAGCATCTGGTTTTTTGTTTTTTGTTTTTGTCTGAACTGTAGCTAATTTTACTACATTGTTTGCCA

TTATGTCTGTGCTCAAGATTCCCCACCCAACTCTCAGCCAATCCCATTATTTGTATTGGTGGTGATTTCAAATGGTTACCAAGTAAATGTAAATTCTAGA

ATGAGTACTGAAAATCCTGAGGAAAAATAGCCAATAAACAGGAGCCACTTTTAACCAGG
Translation
MASVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPFAEKTGICKIRPPK - UNI4928 - DWQPPFACEVKTFRFTPRVQRLNELE - UNI

23251 - AMTRVRLDFLDQLAKFWELQGSTLKIPVVERKILDLYALSK - UNI2846 - IVASKGGFEIVTKEKKWSKVGSRLGYLPGKGTGSLLKS

HYERILYPYELFQSGVSLM - UNI4379 - GVQMPDLDLKEKVEAEVLSTDIQPSPERGTRMNIPPKRTRRVKSQ SDSGEVNRNTELKKLQIFGAGP

KVVGLAVGAKDKED DEVTRRRKVTNRSDAFNMQMRQRKGTLSVNF - UNI3889 - VDLYVCMFCGRGNNEDKLLLCDGCDDSYHTFCLLPPLPDVP

KGDWRCPKCVAE ECNKPREAFGFEQAVREYTLQSFGEMADNFKSDYFNMPVH MVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSGFPKKDGQR

KMLPEEE EYALSGWNLNNMPVLEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHW WGEPKTWYGVPSHAAEQLEEVMRELAPELF

ESQPDLLHQLVTIMNPNVLMEHGVP - UNI7382 - VYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADW LPIGRQCVNHYRRLRRHCVFS

HEELIFKMAADPECLDVGLAAMVCKELTLMTEEETRLRESVVQM GVVMSEEEVFELVPDDERQCSACRTTCFLSALTCSCNPERLVCLYHPTDLCSCPM

QNKCLR RYRYPLEDLPSLLYGVKVRAQSYDTWVNRVTEALSASFNHKKD - UNI35985 - DLIELRVMLEDAEDRKYPENDLFRKLRDAVKEAETC

GSVAQLLLSKKQKHR RQSSDSGKTRTKLTVEELKAFVQQLVSLPCVISQTRQVK NLLDDVEEFHERAQEAMMDETPDSSKLQMLIDMGSSLYVELPEL

PRLKQELQQARWLDEVRLTLSDPQQVTLDVMKKLIDSGVGLAPHHAVEKAMAELQELLTVSERWEEKAKVCLQAR RPRHSMANLENIVNEAKNIPAFLP

NVLSLKEALQKAREWTAKVEAIQ SGNNYAYLEQLESLSAKGRPIPVRLDALPQVESQVAAARAWRERTGRTFLKKNSSHTLLQ VLSPRTDIGVYGSGK

NRRKKVKEIIEKEKEKDLDLEPLSDLEEGLEESRDTAMV VAVFKEREQKEIEAMHSLRAANLAKMTIVERIEEVKFCICRKTASGFMLQCELCKDWFHN

SCVPLPKSSSQKKGSSWQAKDVKFLCPLCMRSRRPRLETILSLLVSLQKLPVRLPEGEALQCLTERAMSWQDKARQALATDELSSALAKLSVLSQRMVEQ

AAREKTEKIISAELQKAAANPDLQ GHLPSFQQSAFNRVVSSVSSSPHQTMDYDDEETDSDEDIRETYGYDMK DTASVKSSSSLEPNLFCDEEIPIKSE

EVVTHMWTAPSFCAEHAYSSASKSCSQG GSSTPRKQPRKSPLVPRSLEPPVLELSPGAKAQLEELMMVGDLLEVSLDETQHIWRILQATHPPSEDRFLH

IME DDSIEEKPLKMKGKDSSEKKRKRKLEKVEQLFGEGKQKTKELKKIDKPKKKKLKLNVDKSKELNKLAKKLAKEEERKKKKEKAAAAKVELVKESTE

KKRERKVLDIPSKYDWSGAEESDDENAVCAAQNCQRPCKDK R
Transcript ENSMUST00000100996
Sequence
GCGCCGGAAGCGCGCGTTCCACCTTGCGGGGTAGCTTTTCCCTCGCCTCTCCTCGAGAGAGGTCGCGGCGCCTTGAGGGGCCGCGCACCCGGGGTGGACG

GAGGGCGCAGAACTTTGACAGGCAAGCTGTGAGAAAACAAAAAACCAAAATAAAACAAAAAAGCTCCGCCGGCCGTCATGGAAGGGAGCGAGGAGAGAAG

ACCCGACTAGACGTGGCGGCGGTGGGATTTTGTTTCCTGCGGTGGCGGACTGATTTAGCAGCACGTTAACTTCCGGGAGCGTCCTGCCCCTGAGAGGAAA

AGCCCTGAAGGAAACAATAACAAACGAGCGGAGGGAGAGCGGCTGGCGCTCCTGTGAGGACTCGTTCTCGTCCTAAGAAGATGCGCTGCGGCCCCAGTGC

GGGGACGTGAGAGGG - UNI4928 - TTGGTGGCCGTCAGCCAAGCCTTTCCTCGCTTGTGCACCTCAGGCCCCCCTGGCTTTTTATTTTATTTTTTG

GTGACCATGGCGTCCGTGGGCCCGGGGGGCTACGCGGCGGAGTTCGTGCCACCGCCCGAGTGCCCGGTCTTTGAGCCCAGTTGGGAGGAGTTCACAGACC

CGCTGAGTTTTATCGGGCGCATCCGGCCCTTTGCGGAGAAAACGGGCATCTGCAAAATCCGGCCACCCAAG - UNI4928 - GATTGGCAACCTCCAT

TTGCCTGTGAAGTAAAAACCTTCCGTTTCACTCCTAGAGTCCAGCGCCTGAATGAACTTGAG - UNI23251 - GCAATGACTAGAGTAAGATTGGAC

TTCTTGGATCAACTGGCAAAATTTTGGGAACTTCAAGGATCTACATTGAAGATCCCTGTGGTGGAGAGAAAAATCCTGGATTTGTATGCTTTAAGCAAG 

- UNI2846 - ATTGTTGCCAGCAAAGGAGGTTTTGAAATAGTCACCAAAGAGAAGAAATGGTCTAAAGTGGGTAGCCGCTTGGGATATCTGCCAGGAA

AAGGAACTGGGTCTCTTTTGAAGTCACACTATGAAAGAATTCTCTACCCATATGAACTTTTCCAATCTGGTGTCAGCCTTATG - UNI4379 - GGTG

TACAAATGCCTGATTTAGATCTTAAAGAAAAAGTTGAGGCTGAGGTTCTCAGCACTGACATCCAGCCTTCCCCAGAGCGGGGAACAAGAATGAATATTCC

ACCAAAGAGAACAAGACGAGTTAAGTCTCAG TCAGACTCTGGAGAAGTAAATAGAAACACAGAACTGAAGAAACTTCAGATTTTTGGGGCTGGACCCAA

AGTTGTGGGCCTGGCAGTAGGAGCAAAAGATAAAGAAG ATGAAGTCACCCGAAGAAGAAAAGTTACCAACAGGTCAGATGCATTTAACATGCAAATGAG

ACAACGGAAAGGAACTCTCTCTGTTAACTTT - UNI3889 - GTTGATCTCTATGTTTGCATGTTTTGTGGTCGAGGAAATAATGAGGATAAACTGCT

TTTGTGTGATGGGTGCGATGACAGCTATCATACATTTTGTCTACTTCCACCACTACCTGATGTCCCCAAAGGAGACTGGAGGTGTCCTAAATGTGTTGCT

GAG GAATGTAACAAACCTCGAGAAGCCTTTGGATTTGAGCAAGCTGTAAGAGAATATACACTTCAAAGCTTTGGAGAGATGGCAGATAATTTTAAATCT

GATTATTTCAATATGCCAGTCCAT ATGGTTCCTACAGAGCTAGTAGAAAAAGAATTCTGGCGGCTAGTAAGTAGCATTGAAGAAGATGTTATTGTAGAG

TATGGAGCTGATATCTCTTCAAAAGATTTTGGAAGTGGATTTCCTAAAAAGGATGGTCAAAGAAAGATGTTGCCAGAAGAAGAG GAATATGCACTTTCT

GGTTGGAATTTGAATAACATGCCTGTTCTGGAGCAGTCCGTTCTTGCACATATTAATGTGGACATTTCTGGTATGAAGGTGCCATGGCTCTATGTGGGAA

TGTGCTTTTCTTCTTTTTGCTGGCATATTGAAGATCACTGGAGTTATTCCATTAACTACTTGCATTG GGGCGAGCCAAAGACATGGTATGGTGTACCAT

CTCATGCTGCAGAACAACTGGAGGAGGTGATGAGGGAGCTGGCCCCTGAGTTATTTGAATCCCAGCCTGATCTCCTACATCAGTTAGTAACCATCATGAA

CCCAAATGTGCTCATGGAGCATGGTGTGCCT - UNI7382 - GTGTACAGGACTAATCAGTGTGCTGGAGAGTTTGTGGTGACGTTTCCTCGTGCCTA

TCACTCTGGATTTAACCAGGGATACAACTTTGCCGAAGCGGTGAACTTCTGTACTGCTGACTGG TTGCCCATTGGACGTCAGTGTGTAAATCACTATCG

ACGGCTCAGGCGCCATTGTGTCTTTTCACATGAGGAACTCATTTTCAAGATGGCAGCAGATCCAGAATGCTTAGATGTGGGGCTGGCTGCCATGGTATGC

AAAGAGTTGACTCTCATGACTGAAGAAGAAACACGATTGAGAGAATCAGTTGTTCAAATG GGTGTCGTGATGTCAGAAGAAGAAGTCTTTGAACTTGTT

CCTGATGATGAGCGGCAGTGTTCAGCATGCAGAACTACATGTTTTCTCTCAGCTCTCACATGCTCCTGTAATCCGGAGCGACTTGTATGTCTGTATCATC

CAACTGATTTGTGCTCTTGCCCCATGCAGAACAAATGTCTTAG GTACCGCTATCCACTAGAAGACCTTCCATCTCTGCTTTATGGTGTCAAAGTGAGAG

CACAATCCTATGACACTTGGGTCAATCGTGTTACAGAAGCATTGTCAGCTAGCTTCAACCATAAGAAAG - UNI35985 - ATTTGATTGAATTGAGA

GTAATGCTGGAAGATGCTGAGGATAGGAAATACCCAGAGAATGATCTCTTTCGAAAGCTCAGGGACGCGGTGAAAGAAGCTGAGACCTGTGGTTCTGTGG

CTCAGCTGCTTCTGAGCAAAAAGCAAAAACACAG GCAGAGCTCAGATAGTGGGAAGACTCGGACCAAACTGACAGTAGAAGAATTGAAGGCCTTTGTCC

AACAACTTGTTAGTCTTCCGTGTGTCATCAGCCAAACTCGACAAGTAAAG AATCTGCTGGATGATGTAGAAGAATTTCATGAACGTGCCCAGGAGGCCA

TGATGGATGAAACCCCAGATTCTTCCAAACTCCAAATGTTAATAGACATGGGCTCTAGTCTCTATGTGGAGCTACCTGAATTGCCCCGACTAAAGCAAGA

GCTCCAGCAGGCTCGATGGCTGGATGAAGTAAGGCTAACTCTATCAGATCCACAACAAGTCACTTTGGATGTCATGAAGAAATTGATTGACTCTGGCGTA

GGCTTGGCACCTCACCATGCTGTAGAAAAAGCAATGGCCGAACTACAGGAACTCCTTACAGTCTCTGAACGATGGGAAGAGAAGGCTAAGGTCTGCCTGC

AAGCAAG ACCTCGGCACAGTATGGCAAATTTAGAAAATATTGTGAATGAAGCCAAGAACATTCCAGCCTTTCTACCCAATGTGTTGTCCTTAAAAGAAG

CCTTACAAAAGGCTCGTGAATGGACAGCTAAAGTGGAAGCTATTCAG AGTGGCAACAACTATGCTTACTTGGAACAGCTTGAGAGCCTATCTGCTAAAG

GACGCCCTATCCCTGTGCGTCTTGATGCCTTGCCTCAAGTGGAGTCACAGGTAGCAGCAGCACGGGCCTGGAGAGAACGTACTGGGCGGACCTTCCTTAA

AAAGAATTCCAGCCATACATTGTTACAG GTGCTAAGTCCACGAACTGACATTGGTGTATATGGGAGTGGTAAAAACAGGAGGAAAAAGGTAAAAGAAAT

AATAGAAAAAGAAAAGGAGAAGGACCTCGACCTTGAGCCTTTGAGTGACTTAGAGGAAGGACTGGAGGAGTCAAGAGATACAGCCATGGTG GTGGCAGT

TTTCAAAGAACGAGAGCAAAAGGAGATTGAAGCCATGCATTCCCTCAGAGCAGCCAACCTAGCCAAGATGACAATTGTGGAGCGCATAGAAGAAGTGAAA

TTTTGTATTTGCCGCAAGACAGCCAGTGGGTTTATGCTACAGTGTGAGCTCTGCAAAGACTGGTTCCATAACAGCTGTGTTCCCCTTCCTAAATCAAGTT

CCCAGAAAAAGGGATCCAGCTGGCAGGCTAAAGATGTAAAATTCCTTTGCCCTCTTTGCATGAGATCTCGGAGGCCAAGGCTAGAGACTATTCTGTCACT

CCTGGTATCCCTTCAGAAGTTGCCTGTACGGTTGCCGGAAGGAGAAGCACTGCAGTGTTTGACAGAACGTGCCATGAGTTGGCAAGATAAAGCACGCCAA

GCTTTAGCCACAGATGAACTGTCCTCTGCCCTGGCCAAGCTCTCTGTGCTAAGCCAGCGTATGGTGGAACAAGCAGCTAGAGAAAAAACTGAAAAGATTA

TCAGTGCAGAACTCCAAAAAGCAGCTGCCAATCCAGATTTACAG GGACACTTACCTAGTTTCCAGCAGTCTGCTTTTAACCGGGTGGTGAGCAGTGTAT

CATCTTCCCCCCACCAAACAATGGACTATGATGATGAAGAAACAGATTCTGATGAAGATATTCGGGAGACATACGGCTATGACATGAAG GATACAGCCA

GCGTGAAGTCCTCTAGTAGTCTGGAACCCAATCTCTTTTGTGATGAAGAGATTCCCATCAAGTCTGAGGAAGTGGTGACTCACATGTGGACGGCACCGTC

ATTCTGTGCAGAGCATGCATATTCTTCTGCTTCAAAGAGTTGTTCTCAAG GTTCTAGCACTCCAAGAAAGCAGCCTCGGAAGAGCCCTTTGGTTCCCAG

AAGTTTGGAGCCTCCAGTATTGGAATTGTCTCCTGGAGCAAAAGCCCAGTTGGAAGAACTCATGATGGTTGGAGACCTCCTAGAAGTGTCTCTGGATGAG

ACACAACACATTTGGCGGATTTTGCAGGCCACACATCCACCCTCAGAGGACAGATTCTTACATATCATGGAG GATGATAGCATAGAAGAGAAACCATTA

AAAATGAAAGGAAAGGACTCTTCAGAGAAGAAACGGAAACGGAAGCTAGAAAAGGTAGAACAGCTTTTTGGAGAAGGAAAACAGAAGACCAAGGAGCTAA

AGAAAATAGATAAACCTAAAAAGAAGAAATTAAAATTAAATGTGGACAAATCAAAAGAGCTGAATAAATTGGCCAAGAAGTTAGCTAAAGAAGAAGAGCG

AAAGAAAAAGAAAGAAAAGGCTGCTGCCGCCAAAGTGGAGCTTGTGAAAGAGAGCACGGAGAAGAAACGGGAGAGGAAGGTGTTGGATATCCCCTCAAAG

TATGACTGGTCGGGGGCAGAGGAGTCTGATGATGAGAATGCTGTGTGTGCAGCCCAAAACTGCCAAAGGCCGTGTAAGGACAAGGTG
Translation
EDALRPQCGDVRG - UNI4928 - LVAVSQAFPRLCTSGPPGFLFYFLVTMASVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPFAEKTGI

CKIRPPK - UNI4928 - DWQPPFACEVKTFRFTPRVQRLNELE - UNI23251 - AMTRVRLDFLDQLAKFWELQGSTLKIPVVERKILDLYALS

K - UNI2846 - IVASKGGFEIVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLM - UNI4379 - GVQMPDLDLKEKVEAE

VLSTDIQPSPERGTRMNIPPKRTRRVKSQ SDSGEVNRNTELKKLQIFGAGPKVVGLAVGAKDKED DEVTRRRKVTNRSDAFNMQMRQRKGTLSVNF -

 UNI3889 - VDLYVCMFCGRGNNEDKLLLCDGCDDSYHTFCLLPPLPDVPKGDWRCPKCVAE ECNKPREAFGFEQAVREYTLQSFGEMADNFKSDYF

NMPVH MVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSGFPKKDGQRKMLPEEE EYALSGWNLNNMPVLEQSVLAHINVDISGMKVPWLYVGMC

FSSFCWHIEDHWSYSINYLHW WGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIMNPNVLMEHGVP - UNI7382 - VYRTNQCAGE

FVVTFPRAYHSGFNQGYNFAEAVNFCTADW LPIGRQCVNHYRRLRRHCVFSHEELIFKMAADPECLDVGLAAMVCKELTLMTEEETRLRESVVQM GVV

MSEEEVFELVPDDERQCSACRTTCFLSALTCSCNPERLVCLYHPTDLCSCPMQNKCLR RYRYPLEDLPSLLYGVKVRAQSYDTWVNRVTEALSASFNHK

KD - UNI35985 - DLIELRVMLEDAEDRKYPENDLFRKLRDAVKEAETCGSVAQLLLSKKQKHR RQSSDSGKTRTKLTVEELKAFVQQLVSLPCVI

SQTRQVK NLLDDVEEFHERAQEAMMDETPDSSKLQMLIDMGSSLYVELPELPRLKQELQQARWLDEVRLTLSDPQQVTLDVMKKLIDSGVGLAPHHAVE

KAMAELQELLTVSERWEEKAKVCLQAR RPRHSMANLENIVNEAKNIPAFLPNVLSLKEALQKAREWTAKVEAIQ SGNNYAYLEQLESLSAKGRPIPVR

LDALPQVESQVAAARAWRERTGRTFLKKNSSHTLLQ VLSPRTDIGVYGSGKNRRKKVKEIIEKEKEKDLDLEPLSDLEEGLEESRDTAMV VAVFKERE

QKEIEAMHSLRAANLAKMTIVERIEEVKFCICRKTASGFMLQCELCKDWFHNSCVPLPKSSSQKKGSSWQAKDVKFLCPLCMRSRRPRLETILSLLVSLQ

KLPVRLPEGEALQCLTERAMSWQDKARQALATDELSSALAKLSVLSQRMVEQAAREKTEKIISAELQKAAANPDLQ GHLPSFQQSAFNRVVSSVSSSPH

QTMDYDDEETDSDEDIRETYGYDMK DTASVKSSSSLEPNLFCDEEIPIKSEEVVTHMWTAPSFCAEHAYSSASKSCSQG GSSTPRKQPRKSPLVPRSL

EPPVLELSPGAKAQLEELMMVGDLLEVSLDETQHIWRILQATHPPSEDRFLHIME DDSIEEKPLKMKGKDSSEKKRKRKLEKVEQLFGEGKQKTKELKK

IDKPKKKKLKLNVDKSKELNKLAKKLAKEEERKKKKEKAAAAKVELVKESTEKKRERKVLDIPSKYDWSGAEESDDENAVCAAQNCQRPCKDKV

For any suggestions or comments, please send an email to unitrap@crg.es