Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030200 (Bcl2l14)
Chromosomal location
Chr 6: 134346347 - 134388742 (+)
Description
BCL2-like 14 (apoptosis facilitator) Gene [Source:MGI (curated);Acc:Bcl2l14-001]
RefSeq_dna
NM_025778 
RefSeq_peptide
NP_080054.1 
UniGene
Mm.474472 
MGI
MGI:1914063 
Uniprot/SWISSPROT
Q9CPT0 
Human Ortholog
ENSG00000121380 (BCL2L14)
Omim not available
UniTrap UNI25469
Vector Insertion
Chr 6: 134373628 - 134374081
Public Clones not available
Private Clones OST182692 (lexicon) OST68317 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111960
Sequence
GAAGTGGCTTCCTTTCTTAAGCCTCAGATGTGGTCCCAAACCTGAGAAGCCTGTGCCTGGGAGCTTCCAGCCACTGAGCTGTGTCGTGAGAAGCCAAGAC

CTGTGGAAGGTTTCCTCTCAGTTGCACATTCAGGGACACTGGTGTACAAATAGCCACCTGAGACCTGACCTGAAGCCAGAGGAAACCGGCTGAAAACCTG

CAGATCAG - UNI25469 - ACCCAGCATGTGCAGCACCAGTGTGTATGACCTGGAAGACATTCCCCTGGAGGATGATGATCCAAACAGCATAGAGTT

CAAAATCCTGGCCTTCTACGCCAGACACCATGTCTTCAAGAACACCCCGGCTGTCTTCTCGCCCAAGCTCTCCAGAACAAGGAGTCTGTCCCAGAAAGCC

CTGGGGACTTGGTCAACTGATTCCTGGACACAGGTATCATTGCCTTGCAGAGGTTCCCCCTCCAGCGAAAAGAACATCAGCTTGGGCAAGAAGAAGTCTT

CTTGGAGAACACTCTTCAGGGTGGCCGAGAAGGAGGAAGGCCTGCCGAGCTCCCCAAAGGAGATCCGAGCTCAGGGTCCTCAGGGCCCCTTCCCGGTAGA

GCGGCAGAGTGGCTTCCACAACCAGCACTGGCCCAGGTCTCTGAGCAGTGTGGAGCAGCGCCTGGAGAGTGAAG - UNI25469 - TTGTGGATTCCA

AAGTGGCTTGTATTGCCAACAGAGTGGCTGAAATTGTTTACTCCTGGCCACCACCAGATGTCATCCACAGCCAGGGAGGAAGCAAGCTCAAAGAGAGGGT

CTCGGAGATTCTGTACTTCAGGTTTGAAGGACCTTGTGACTCTAAGAATAAAG ATGGAGAAGACCAAATAATAAGCAAGATTGTTGAGCTGCTGAAATT

CTCGGGGGATCAGTTGGGAAGAGAG ATAAAGAAAGACAAGGCTTTGATGAGCAGCTTCCAGGACGGGCTGTCCTACTCAACGTTCAAGACCATCACAGA

CCTGTTCCTGAGGGACGTGGACACCAGAGGAGAATCAGAGGTCAAAGCTCGGGGCTTCAAGGCTGCCCTTGCAATAGACGCCATCGCCAAGCTCACGGCC

ATCGACAACCACCCAATGAATAGAATGCTGGGCTTCGGGACCAAGTACCTAAGAGAGTACTTCTCCCCCTGGGTTCAGCAGAATGGCGGATGG GAAAAA

ATACTTGGGATCTCACATGAAGAAGTAGACTGAAATAGCCAAAGACCTGTCGCCTGGAAGGTCCCTTGTGCAACAGTGGTTCTGTGTGCCCACCACTCTT

ACCATAGACTTCAGGAGAAAGTTAAAACATACCCAGCAGACAGTGTCTAGAGAACCATCTTTCCTTTGACTCAAGAGGCATCGGGAGAGGCCTTGCTCTC

TTCAGCTCATAGAACTCAGTAGCACGGACTTCGCTGAGGGCACTCGAGTCCTCCACTGAATGTGTGAGGGGCTCCATAAAGATAAGTGATTGTTTTACCT

CTAAATGTTGAGAACGGAAACCATCCTGTTGCTACACCAGTGGAAGCATTCGTTCGGCACGTGTCTGTCGGTCTCATGGAGGTGAAACGATAAATATGTG

TGTGCTTAC
Translation
 - UNI25469 - MCSTSVYDLEDIPLEDDDPNSIEFKILAFYARHHVFKNTPAVFSPKLSRTRSLSQKALGTWSTDSWTQVSLPCRGSPSSEKNISLG

KKKSSWRTLFRVAEKEEGLPSSPKEIRAQGPQGPFPVERQSGFHNQHWPRSLSSVEQRLESEV - UNI25469 - VVDSKVACIANRVAEIVYSWPPP

DVIHSQGGSKLKERVSEILYFRFEGPCDSKNKD DGEDQIISKIVELLKFSGDQLGRE IKKDKALMSSFQDGLSYSTFKTITDLFLRDVDTRGESEVKA

RGFKAALAIDAIAKLTAIDNHPMNRMLGFGTKYLREYFSPWVQQNGGW EKILGISHEEVD
Transcript ENSMUST00000032321
Sequence
ACTTTAGCTTAACCCTACTAGTTAAATGGCCTCTCCTGGCCTAATCTGGCAAAACCCACCACCATGAAGAACATCGGCACAAGAGGGAAAT GCAAACAG

GGTCAAGGCAGAGACCAAGTCAGTAGACTGTAATGCAGAAGACCAATAAGTACTGAAAGATGCACTCCAAACCTATGAAGGGACAGTGTGTGGAACAGTG

AGCCAGCCTACCTTGCAGGGCCTGTCAACGCTTCTGAAGGAG - UNI25469 - ACCCAGCATGTGCAGCACCAGTGTGTATGACCTGGAAGACATTC

CCCTGGAGGATGATGATCCAAACAGCATAGAGTTCAAAATCCTGGCCTTCTACGCCAGACACCATGTCTTCAAGAACACCCCGGCTGTCTTCTCGCCCAA

GCTCTCCAGAACAAGGAGTCTGTCCCAGAAAGCCCTGGGGACTTGGTCAACTGATTCCTGGACACAGGTATCATTGCCTTGCAGAGGTTCCCCCTCCAGC

GAAAAGAACATCAGCTTGGGCAAGAAGAAGTCTTCTTGGAGAACACTCTTCAGGGTGGCCGAGAAGGAGGAAGGCCTGCCGAGCTCCCCAAAGGAGATCC

GAGCTCAGGGTCCTCAGGGCCCCTTCCCGGTAGAGCGGCAGAGTGGCTTCCACAACCAGCACTGGCCCAGGTCTCTGAGCAGTGTGGAGCAGCGCCTGGA

GAGTGAAG - UNI25469 - TTGTGGATTCCAAAGTGGCTTGTATTGCCAACAGAGTGGCTGAAATTGTTTACTCCTGGCCACCACCAGATGTCATCC

ACAGCCAGGGAGGAAGCAAGCTCAAAGAGAGGGTCTCGGAGATTCTGTACTTCAGGTTTGAAGGACCTTGTGACTCTAAGAATAAAG ATGGAGAAGACC

AAATAATAAGCAAGATTGTTGAGCTGCTGAAATTCTCGGGGGATCAGTTGGGAAGAGAG ATAAAGAAAGACAAGGCTTTGATGAGCAGCTTCCAGGACG

GGCTGTCCTACTCAACGTTCAAGACCATCACAGACCTGTTCCTGAGGGACGTGGACACCAGAGGAGAATCAGAGGTCAAAGCTCGGGGCTTCAAGGCTGC

CCTTGCAATAGACGCCATCGCCAAGCTCACGGCCATCGACAACCACCCAATGAATAGAATGCTGGGCTTCGGGACCAAGTACCTAAGAGAGTACTTCTCC

CCCTGGGTTCAGCAGAATGGCGGATGG GAAAAAATACTTGGGATCTCACATGAAGAAGTAGACTGAAATAGCCAAAGACCTGTCGCCTGGAAGGTCCCT

TGTGCAACAGTGGTTCTGTGTGCCCACCACTCTTACCATAGACTTCAGGAGAAAGTTAAAACATACCCAGCAGACAGTGTCTAGAGAACCATCTTTCCTT

TGACTCAAGAGGCATCGGGAGAGGCCTTGCTCTCTTCAGCTCATAGAACTCAGTAGCACGGACTTCGCTGAGGGCACTCGAGTCCTCCACTGAATGTGTG

AGGGGCTCCATAAAGATAAGTGATTGTTTTACCTCTAAATGTTGAGAACGGAAACCATCCTGTTGCTACACCAGTGGAAGCATTCGTTCGGCACGTGTCT

GTCGGTCTCATGGAGGTGAAACGATAAATATGTGTGTGCTTACTTTTTAGTCTCTAACACTATTTGTTCCTTATACTGCACCTGGGATGCCCTGATTACT

GTCTCGTGTCAAGCTTACCCTCAGGAAGACAGCCCTATTCATGTCAGAGAGAAAAACCTGAGTTTGCTGTTATGTCTAGCTAGCTTAAGTCTTGCTAACC

CGTCCTCTCAAAAACTACTGTGGTACCTTGACAAAGTCCATTTGGTACAAAGCCATCTTCACAGATTTCTCTGTGTGATATACCTGCACCCCACCACATC

AGTGCGATCGAGAGCAAGGGCACACAGGTACCACAAGAAGATACAGAGGTCAACCTCGGGTGCTAGTTTTCATCTTCCTCTTTGTGCATAGCTTCTTACC

CAGGCTGGATCACTCCTGAGCGTCTGGGAGTGTCCCGCCTCCGCCTCCTCCCTTACAGCCACAGCACTAGGGTTGCAGGTGTACCCTGTGACACGCAGCG

TTTTAGGTCGGTGCTGTGGATTCAAATCCAGGTCCTCACACTTCTGTGGCTAGCACTTTACCCACAGTGCTACCTCCCCAGCCTGAGCTCTGGACTATTA

GGACCCCTTAGAAGTAGCATAATGGTTGGTAATTAATAAAATAAATAAATTG
Translation
  - UNI25469 - MCSTSVYDLEDIPLEDDDPNSIEFKILAFYARHHVFKNTPAVFSPKLSRTRSLSQKALGTWSTDSWTQVSLPCRGSPSSEKNISL

GKKKSSWRTLFRVAEKEEGLPSSPKEIRAQGPQGPFPVERQSGFHNQHWPRSLSSVEQRLESEV - UNI25469 - VVDSKVACIANRVAEIVYSWPP

PDVIHSQGGSKLKERVSEILYFRFEGPCDSKNKD DGEDQIISKIVELLKFSGDQLGRE IKKDKALMSSFQDGLSYSTFKTITDLFLRDVDTRGESEVK

ARGFKAALAIDAIAKLTAIDNHPMNRMLGFGTKYLREYFSPWVQQNGGW EKILGISHEEVD

For any suggestions or comments, please send an email to unitrap@crg.es