Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030201 (Lrp6)
Chromosomal location
Chr 6: 134400440 - 134516931 (-)
Description
low density lipoprotein receptor-related protein 6 Gene [Source:MGI (curated);Acc:Lrp6-001]
RefSeq_dna
NM_008514 
RefSeq_peptide
NP_032540.2 
UniGene
Mm.321990 
MGI
MGI:1298218 
Uniprot/SWISSPROT
O88572 
Uniprot/SPTREMBL
Q3TS86 Q3US54 
Human Ortholog
ENSG00000070018 (LRP6)
Omim 610947 - CORONARY ARTERY DISEASE, AUTOSOMAL DOMINANT 2  
UniTrap UNI11253
Vector Insertion
Chr 6: 134492064 - 134516660
Public Clones G023C12 (ggtc)
Private Clones OST381683 (lexicon) OST346247 (lexicon) OST309546 (lexicon) OST308190 (lexicon)
OST297894 (lexicon) OST262755 (lexicon) OST108592 (lexicon) OST52514 (lexicon)
OST38808 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10329
Vector Insertion
Chr 6: 134470612 - 134491669
Public Clones LST067 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10380
Vector Insertion
Chr 6: 134461306 - 134463240
Public Clones Ex187 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1117
Vector Insertion
Chr 6: 134434459 - 134435661
Public Clones CC0361 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10331
Vector Insertion
Chr 6: 134430579 - 134434231
Public Clones XST013 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10295
Vector Insertion
Chr 6: 134421312 - 134429526
Public Clones PST096 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10314
Vector Insertion
Chr 6: 134417718 - 134418660
Public Clones Ex510 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10294
Vector Insertion
Chr 6: 134407787 - 134409249
Public Clones PST094 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000032322
Sequence
GGCGGCGGCATGGGGGCAGGCGCTGGCGTCGCGCGAGCCCGGGCCGGAGCGGCGCGCTAGAGCCCTGACGTGCGCCCTTTTCTTTCTTCTCGCGGCCGCG

GAAAGCATGAGCGTGCAGACCCGCCGCTGCGGCGGCCGCCCCGGCTCCTCGCCCGCGCGTCCCCTGGCCGCCGGGCGCCGGTGAGGGCCGCGAGCGCGCG

CGGTGGTGGGGGGAAGATGGGGGCCGTGCTGAGGAGCCTCCTGGCCTGCAGCTTCTGCGTGCTGCTGAGAG - UNI11253 - CGGCCCCTTTGTTGC

TTTATGCAAACAGACGGGACTTGAGATTGGTTGATGCTACAAATGGCAAAGAGAATGCAACGATTGTAGTTGGAGGCTTGGAGGATGCAGCTGCGGTGGA

CTTTGTGTTTGGTCATGGCTTGATATACTGGAGTGATGTCAGCGAAGAAGCCATTAAACGAACAGAATTTAACAAAACTGAAAGTGTACAGAATGTTGTT

GTTTCTGGATTATTGTCCCCGGATGGGCTGGCATGTGATTGGCTTGGAGAAAAATTGTACTGGACAGATTCTGAAACTAATCGTATTGAAGTTTCTAATT

TAGATGGATCTTTACGAAAAGTTTTATTTTGGCAAGAGTTGGATCAACCCAGAGCTATTGCCTTAGATCCATCAAGTGG - UNI10329 - GTTCATG

TACTGGACAGACTGGGGAGAAGTGCCAAAGATAGAACGTGCTGGGATGGATGGCTCAAGTCGCTTCGTTATAATAAACACAGAGATTTACTGGCCAAACG

GACTGACTCTGGACTATCAGGAGCGGAAGCTTTACTGGGCCGATGCAAAACTTAATTTCATCCATAAATCAAACCTGGATGGAACAAACCG GCAGGCAG

TGGTTAAAGGTTCCCTTCCACATCCTTTTGCCTTGACGTTATTTGAGGACACATTGTACTGGACTGACTGGAATACACACTCTATTTTGGCTTGCAACAA

ATATACTGGCGAGGGTCTGCGTGAAATTCATTCTAACATCTTCTCTCCCATGGATATACATGCTTTCAGCCAACAGAGGCAGCCAAATG - UNI10380

 - CTACAAATCCATGTGGAATTGATAATGGTGGTTGTTCCCATTTGTGTTTGATGTCTCCAGTCAAGCCTTTTTATCAGTGTGCTTGCCCAACTGGGGT

CAAGCTGCTGGAGAATGGAAAGACCTGCAAAGATG GTGCCACTGAACTATTGCTGTTAGCCCGACGGACAGACTTGAGGCGAATTTCTTTGGATACACC

CGATTTTACTGACATTGTTCTGCAGTTAGAAGATATCCGGCATGCCATTGCCATAGACTATGACCCTGTAGAAGGCTACATATACTGGACGGATGACGAA

GTGAGGGCTATCCGTCGCTCCTTCATAGATGGATCTGGCAGTCAGTTTGTGGTCACGGCCCAGATTGCTCATCCTGATGGTATTGCTGTTGACTGGGTTG

CAAGGAACCTGTACTGGACAGACACTGGCACGGATCGTATAGAAGTGACAAGGCTCAATGGGACCATGAGGAAGATCTTGATTTCAGAGGACTTAGAGGA

GCCCCGGGCTATCGTGTTAGATCCCATGGTTGG GTACATGTATTGGACAGACTGGGGAGAAATCCCAAAAATAGAGCGAGCTGCTCTGGACGGATCTGA

CCGAGTAGTTCTTGTCAACACTTCCCTTGGTTGGCCAAACGGCTTAGCCCTGGATTATGATGAAGGCACAATATACTGGGGAGATGCCAAAACAGACAAA

ATTGAG GTTATGAATACCGATGGCACCGGGAGGCGAGTGCTGGTGGAAGACAAGATCCCTCACATATTTGGGTTTACCTTGCTGGGTGACTATGTTTAC

TGGACTGACTGGCAGAGGCGGAGCATCGAGAGAGTACACAAACGGAGCGCAGAGAGGGAGGTCATCATAGATCAGCTGCCAGACCTCATGGGACTGAAGG

CCACAAGTGTTCACAGAATCATTG GTTCTAACCCCTGTGCTGAGGACAATGGAGGATGTAGCCATCTTTGCCTGTACAGGCCTCAGGGGCTTCGATGCG

CCTGTCCCATTGGCTTTGAGCTCATCAGTGACATGAAGACATGCATTGTCCCCGAGGCTTTCCTTCTGTTCTCGAGGAGAGCGGATATCAGACGCATATC

TTTGGAAACAAACAACAACAATGTGGCCATTCCTCTCACTGGTGTCAAAGAAGCCTCTGCTTTGGATTTTGATGTCACAGACAACAGGATTTACTGGACT

GATATATCACTGAAG - UNI1117 - ACTATTAGCAGAGCCTTTATGAATGGCAGTGCACTGGAACATGTGGTAGAGTTTGGCTTAGATTATCCAGAA

GGCATGGCAGTGGACTGGCTTGGGAAGAACTTATACTGGGCAGACACAGGAACAAATCGCATTGAGGTATCGAAGTTGGACGGACAGCACCGACAGGTTT

TGGTATGGAAAGACCTTGACAGTCCTCGAGCTCTGGCACTGGATCCTGCTGAAGG - UNI10331 - GTTTATGTATTGGACTGAGTGGGGAGGCAAG

CCTAAGATTGACAGGGCTGCTATGGATGGAAGTGAACGCACTACATTAGTTCCAAATGTAGGCCGAGCAAATGGTCTCACCATCGACTATGCTAAAAGGC

GGCTTTACTGGACAGACCTGGACACTAACCTAATAGAATCCTCAGATATGCTCG GACTCAACCGTGAAGTTATAGCAGATGACTTGCCTCATCCTTTTG

GCTTAACTCAGTACCAAGATTACATCTACTGGACAGACTGGAGCCGACGCAGCATTGAACGTGCCAACAAAACCAGTGGCCAAAACCGCACCATCATCCA

GGGCCATTTGGACTATGTGATGGACATCCTGGTCTTCCACTCTTCCCGGCAGGCAGGGTGGAATGAGTGTGCCTCCAGCAACGGGCACTGCTCCCACCTC

TGCTTGGCTGTGCCCGTCGGAGGTTTTGTGTGTGGATGCCCTGCCCACTACTCCCTGAATGCTGACAACAGGACCTGCAGTG - UNI10295 - CTCC

CACCACCTTCCTGCTCTTCAGTCAGAAGAGCGCCATCAACCGCATGGTGATTGATGAACAACAGAGCCCTGACATCATCCTTCCTATCCACAGCCTTCGG

AACGTCCGGGCCATTGACTATGACCCTTTGGACAAGCAGCTCTACTGGATTGACTCTCGACAAAACTCCATACGAAAGGCACATGAAGATGGTGGCCAG 

GGTTTTAATGTAGTTGCAAACTCAGTCGCAAATCAGAACCTTGAAATACAGCCCTATGATCTCAGCATTGATATTTATAGCCGTTACATCTACTGGACCT

GTGAAGCTACCAATGTCATTGATGTGACGAGATTAGATGGACGATCAGTTGGAGTGGTTCTAAAAGGCGAGCAAGACAGACCTCGAGCCATTGTGGTAAA

CCCCGAGAAAGG - UNI10314 - GTATATGTATTTTACCAATCTTCAGGAAAGATCTCCTAAAATTGAACGGGCTGCATTGGATGGTACAGAACGAG

AGGTCCTCTTTTTCAGTGGCTTAAGTAAACCAATTGCTTTGGCTCTTGATAGCAAGCTGGGCAAGCTCTTCTGGGCTGACTCAGATCTCCGGCGAATTGA

AAGCAGTGATCTCTCAG GTGCCAACAGGATCGTGCTAGAAGACTCTAATATATTACAGCCTGTGGGCCTGACCGTGTTTGAAAACTGGCTCTATTGGAT

TGATAAACAGCAGCAGATGATTGAAAAAATTGACATGACTGGTCGAGAAGGAAGAACCAAGGTCCAGGCTCGAATTGCTCAGCTGAGTGACATCCATGCA

GTAAAGGAGCTGAACCTTCAGGAGTACA GACAGCACCCTTGTGCCCAGGATAATGGTGGCTGTTCACATATCTGCCTTGTAAAAGGAGATGGTACGACA

AGATGCTCCTGCCCCATGCACTTAGTTCTGCTTCAGGATGAGCTGTCCTGTGGAG AGCCTCCAACGTGTTCTCCTCAGCAGTTTACCTGCTTCACTGGG

GACATTGACTGCATCCCTGTGGCTTGGCGGTGTGATGGGTTCACTGAGTGCGAAGACCACAGCGATGAACTCAATTGTCCCGTGTGCTCAGAGTCTCAGT

TCCAGTGTGCCAGCGGGCAGTGCATTGATGGTGCCCTTCGATGCAATGGCGATGCGAACTGCCAGGACAAATCAGATGAGAAGAACTGTGAAG - UNI1

0294 - TGCTTTGTTTAATTGATCAGTTCCGCTGTGCCAATGGTCAGTGCGTTGGAAAGCACAAGAAATGTGACCACAGTGTGGACTGCAGTGACAGAT

CTGACGAGCTGGACTGTT ATCCAACTGAGGAGCCAGCACCACAAGCCACCAACACAGTTGGTTCTGTTATTGGAGTAATTGTCACCATTTTTGTGTCTG

GAACCATATACTTTATCTGCCAGAGGATGCTGTGTCCTCGTATGAAGGGAGACGGGGAGACCATGACTAACGACTATGTGGTTCACAGCCCGGCGTCTGT

GCCCCTTGGTTATGTTCCTCACCCAAGCTCTCTCTCTGGATCTCTTCCAG GAATGTCTCGAGGCAAATCAATGATCAGTTCCCTCAGTATCATGGGGGG

AAGCAGTGGGCCCCCCTATGATCGAGCGCACGTCACGGGAGCCTCCTCAAGCAGTTCTTCCAGTACCAAAGGCACTTACTTCCCTGCA ATTTTGAACCC

ACCACCATCGCCTGCCACAGAAAGATCCCATTATACCATGGAATTTGGTTATTCTTCCAACAGTCCTTCCACACATAGGTCCTACAG CTATAGGCCGTA

CAGCTACCGGCACTTTGCACCGCCCACCACACCCTGCAGCACTGATGTCTGTGACAGTGACTATGCTCCTAGCCGGAGGATGACCTCGGTGGCAACAGCC

AAGGGCTACACCAGTGACGTGAACTATGACTCAGAACCTGTGCCCCCACCGCCCACACCCCGAAGCCAGTACTTGTCAGCGGAGGAGAACTATGAAAGCT

GCCCCCCTTCCCCATACACGGAGAGGAGTTACTCCCACCACCTCTACCCGCCACCACCCTCCCCCTGCACGGACTCCTCCTGAGGAGGGCCCCTCCTCCT

CTGACTGCCTCCACCGGGACATGTAAATACACATCTGGTTGAGATCTGGAGGGGGGGAGGGAGCTATAGAGAAGAGTGAGGCAGACTCTGTACAGTTAAC

ATTATAAAGTGGGTGGGTGCTGGAGATATTTGTACAGAAGAAAAGAATATTTATATATTTTCTTAAAACAGCAGTTTTGCTGCTTGTGCCATAAAAGTTT

GTATAAAAAATAAATTTGTACTAAAAGTTTTATTTTTGCAAACTAAATACACAGAGCATGCCTTAAGCCCAGTGAAGAGACTGAGTACAAAGGAAACAGG

AAAAGAAAGGCATCACTGACCAGGAGTGTCTGGGTTTTAACGATACC
Translation
MGAVLRSLLACSFCVLLRA - UNI11253 - AAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFGHGLIYWSDVSEEAIKRTEFNKTES

VQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSG - UNI10329 - GFMYWTDWGEVPKIERAGMDG

SSRFVIINTEIYWPNGLTLDYQERKLYWADAKLNFIHKSNLDGTNR RQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILACNKYTGEGLREIHSNIFSP

MDIHAFSQQRQPNA - UNI10380 - ATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDG GATELLLLARRTDLRRISLDTPDFTD

IVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAI

VLDPMVG GYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGTIYWGDAKTDKIE VMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWT

DWQRRSIERVHKRSAEREVIIDQLPDLMGLKATSVHRIIG GSNPCAEDNGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRIS

LETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLK - UNI1117 - TISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSK

LDGQHRQVLVWKDLDSPRALALDPAEG - UNI10331 - GFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESS

DMLG GLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGC

PAHYSLNADNRTCSA - UNI10295 - APTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNSIRKAHEDGGQ GF

NVVANSVANQNLEIQPYDLSIDIYSRYIYWTCEATNVIDVTRLDGRSVGVVLKGEQDRPRAIVVNPEKG - UNI10314 - GYMYFTNLQERSPKIER

AALDGTEREVLFFSGLSKPIALALDSKLGKLFWADSDLRRIESSDLSG GANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQA

RIAQLSDIHAVKELNLQEYR RQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGE EPPTCSPQQFTCFTGDIDCIPVAWRCDGFTECEDH

SDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEV - UNI10294 - VLCLIDQFRCANGQCVGKHKKCDHSVDCSDRSDELDCY YP

TEEPAPQATNTVGSVIGVIVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHSPASVPLGYVPHPSSLSGSLPG GMSRGKSMISSLSIMGGSSGPPY

DRAHVTGASSSSSSSTKGTYFPA ILNPPPSPATERSHYTMEFGYSSNSPSTHRSYS SYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYT

SDVNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Transcript ENSMUST00000111950
Sequence
GTGAGCGTGGGAATCAGACTGGGAGAATCTCATCTGCCTGGGCGCGGAGGAGGTCAAGGGAAGCCACACAGAGGCTGGGGAATGGTCCCGGAGGTGTGGG

TGGGATTTAGAGGTAAACCAACAGAACCGCTCTGGGCAGCACAGCACCATCAGCACCATCAGAGAAAGCAGGAAGAAGAAGCAGGCGGAGGGACAGGGCG

GGGAACAGTTACAACAGCTTGATAAGCCGAGTGCTGAGTGTTCTCCCTTTGAAGGACGGTTCTGGACGCGTGCCAAAGCCTTCTTCCCTTAGCTTTACCA

AGCCCTTCCAGTTGGAGATACAGTAACCGCCTCGCCAAACCTCGCGGCTGATGAAGCCCCAGTCCCTCACTGTGTTTTAGATTTGCTCTTTTCTTTTTAA

AGCTCCCACCACCTTCCTGCTCTTCAGTCAGAAGAGCGCCATCAACCGCATGGTGATTGATGAACAACAGAGCCCTGACATCATCCTTCCTATCCACAGC

CTTCGGAACGTCCGGGCCATTGACTATGACCCTTTGGACAAGCAGCTCTACTGGATTGACTCTCGACAAAACTCCATACGAAAGGCACATGAAGATGGTG

GCCAG GGTTTTAATGTAGTTGCAAACTCAGTCGCAAATCAGAACCTTGAAATACAGCCCTATGATCTCAGCATTGATATTTATAGCCGTTACATCTACT

GGACCTGTGAAGCTACCAATGTCATTGATGTGACGAGATTAGATGGACGATCAGTTGGAGTGGTTCTAAAAGGCGAGCAAGACAGACCTCGAGCCATTGT

GGTAAACCCCGAGAAAGG - UNI10314 - GTATATGTATTTTACCAATCTTCAGGAAAGATCTCCTAAAATTGAACGGGCTGCATTGGATGGTACAG

AACGAGAGGTCCTCTTTTTCAGTGGCTTAAGTAAACCAATTGCTTTGGCTCTTGATAGCAAGCTGGGCAAGCTCTTCTGGGCTGACTCAGATCTCCGGCG

AATTGAAAGCAGTGATCTCTCAG GTGCCAACAGGATCGTGCTAGAAGACTCTAATATATTACAGCCTGTGGGCCTGACCGTGTTTGAAAACTGGCTCTA

TTGGATTGATAAACAGCAGCAGATGATTGAAAAAATTGACATGACTGGTCGAGAAGGAAGAACCAAGGTCCAGGCTCGAATTGCTCAGCTGAGTGACATC

CATGCAGTAAAGGAGCTGAACCTTCAGGAGTACA GACAGCACCCTTGTGCCCAGGATAATGGTGGCTGTTCACATATCTGCCTTGTAAAAGGAGATGGT

ACGACAAGATGCTCCTGCCCCATGCACTTAGTTCTGCTTCAGGATGAGCTGTCCTGTGGAG AGCCTCCAACGTGTTCTCCTCAGCAGTTTACCTGCTTC

ACTGGGGACATTGACTGCATCCCTGTGGCTTGGCGGTGTGATGGGTTCACTGAGTGCGAAGACCACAGCGATGAACTCAATTGTCCCGTGTGCTCAGAGT

CTCAGTTCCAGTGTGCCAGCGGGCAGTGCATTGATGGTGCCCTTCGATGCAATGGCGATGCGAACTGCCAGGACAAATCAGATGAGAAGAACTGTGAAG 

- UNI10294 - TGCTTTGTTTAATTGATCAGTTCCGCTGTGCCAATGGTCAGTGCGTTGGAAAGCACAAGAAATGTGACCACAGTGTGGACTGCAGTG

ACAGATCTGACGAGCTGGACTGTT ATCCAACTGAGGAGCCAGCACCACAAGCCACCAACACAGTTGGTTCTGTTATTGGAGTAATTGTCACCATTTTTG

TGTCTGGAACCATATACTTTATCTGCCAGAGGATGCTGTGTCCTCGTATGAAGGGAGACGGGGAGACCATGACTAACGACTATGTGGTTCACAGCCCGGC

GTCTGTGCCCCTTGGTTATGTTCCTCACCCAAGCTCTCTCTCTGGATCTCTTCCAG GAATGTCTCGAGGCAAATCAATGATCAGTTCCCTCAGTATCAT

GGGGGGAAGCAGTGGGCCCCCCTATGATCGAGCGCACGTCACGGGAGCCTCCTCAAGCAGTTCTTCCAGTACCAAAGGCACTTACTTCCCTGCA ATTTT

GAACCCACCACCATCGCCTGCCACAGAAAGATCCCATTATACCATGGAATTTGGTTATTCTTCCAACAGTCCTTCCACACATAGGTCCTACAG CTATAG

GCCGTACAGCTACCGGCACTTTGCACCGCCCACCACACCCTGCAGCACTGATGTCTGTGACAGTGACTATGCTCCTAGCCGGAGGATGACCTCGGTGGCA

ACAGCCAAGGGCTACACCAGTGACGTGAACTATGACTCAGAACCTGTGCCCCCACCGCCCACACCCCGAAGCCAGTACTTGTCAGCGGAGGAGAACTATG

AAAGCTGCCCCCCTTCCCCATACACGGAGAGGAGTTACTCCCACCACCTCTACCCGCCACCACCCTCCCCCTGCACGGACTCCTCCTGAGGAGGGCCCCT

CCTCCTCTGACTGCCTCCACCGGGACATGTAAATACACATCTGGTTGAGATCTGGAGGGGGGGAGGGAGCTATAGAGAAGAGTGAGGCAGACTCTGTACA

GTTAACATTATAAAGTGGGTGGGTGCTGGAGATATTTGTACAGAAGAAAAGAATATTTATATATTTTCTTAAAACAGCAGTTTTGCTGCTTGTGCCATAA

AAGTTTGTATAAAAAATAAATTTGTACTAAAAGTTTTATTTTTGCAAACTAAATACACAGAGCATGCCTTAAGCCCAGTGAAGAGACTGAGT
Translation
MVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNSIRKAHEDGGQ GFNVVANSVANQNLEIQPYDLSIDIYSRYIYWTCEATNVIDVTRLDG

RSVGVVLKGEQDRPRAIVVNPEKG - UNI10314 - GYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSKLGKLFWADSDLRRIESSD

LSG GANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYR RQHPCAQDNGGCSHICLVKGDGTT

RCSCPMHLVLLQDELSCGE EPPTCSPQQFTCFTGDIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEV

 - UNI10294 - VLCLIDQFRCANGQCVGKHKKCDHSVDCSDRSDELDCY YPTEEPAPQATNTVGSVIGVIVTIFVSGTIYFICQRMLCPRMKGDGE

TMTNDYVVHSPASVPLGYVPHPSSLSGSLPG GMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPA ILNPPPSPATERSHYTMEFGY

SSNSPSTHRSYS SYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDVNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLY

PPPPSPCTDSS

For any suggestions or comments, please send an email to unitrap@crg.es