Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030203 (Dusp16)
Chromosomal location
Chr 6: 134665492 - 134742646 (-)
Description
dual specificity phosphatase 16 Gene [Source:MGI (curated);Acc:Dusp16-001]
RefSeq_dna
NM_130447 
RefSeq_peptide
NP_569714.2 
UniGene
Mm.3994 Mm.466207 
MGI
MGI:1917936 
Uniprot/SPTREMBL
Q3UMM5 Q3V436 Q6PCP3 Q920R2 Q99MG5 Q99MG6 
Human Ortholog
ENSG00000111266 (DUSP16)
Omim not available
UniTrap UNI18124
Vector Insertion
Chr 6: 134711453 - 134742294
Public Clones (ggtc) IST14382A8 (tigm) IST14266C4 (tigm) IST14604D4 (tigm) IST10833B5 (tigm)
IST13682G8 (tigm) IST14880C3 (tigm) IST14779A5 (tigm)
Private Clones OST429595 (lexicon) OST307369 (lexicon) OST195167 (lexicon) OST88981 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28021
Vector Insertion
Chr 6: 134689994 - 134708636
Public Clones not available
Private Clones OST42180 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2315
Vector Insertion
Chr 6: 134676014 - 134689829
Public Clones AE0704 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24258
Vector Insertion
Chr 6: 134675853 - 134676013
Public Clones YTC782 (baygenomics)
Private Clones OST226476 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100857
Sequence
CTCTCTCCCCAACCCCCACACTACCCCCCCTGGTCCCCTCCTGCGGGCATCACCGTTTGGGGGGGCTCTCATCCCGTTTCCAACCATTTACCCTCCCCCT

CTCGCTTTTCCCGCGCGGACCCCCAACTTTACCTCAACTTCTTCATCCCTGTCGACATTTTTTTTTCCCTCTTTCGGGGGGCGGTGGAAGAGAAAGTGAA

GAAAAGTTGCAAACGCCCGGGCTCTCGCTAAGCTCTCCGCCCACCCTTCAGAGGAGAAGCCCCGGCGGCGAGGAGGACGCGCGAGCGACGGCTGGGCGAC

GCGGTGACAACGCTCGCTCCCCTCCGCGAGCCTGGAGCCGGCGGCCCCTCAA - UNI18124 - GTTGTCAGCCCAGTGTAAAGCTGTTGGAGTGAGG

GCAGAAAGGTAAAGGATGATGTAATGCCTGGCTGCCCTAGAGCATCTTTTGTTGTGGGATGGGTATTCCCATCATCTCTATGAATCTAGTGTGAGGGGCT

GCTTTGTGGAAGGAATCCTTTGCAAGAGCATATCAACAGGAAAGAGAAAGAGACATTCAGTTGGAGGGCTCTTGCTGAAATGGATTTAACTCTCCTCTTG

CCAGTCACCACTAGCCTGACCTCATACATTTTTAGTACAATGGAGTGGCTGAGCCTTTGAGCACAGCACCATTACATCATCGTGGCAAATTAAAGAACGA

GGTGGGGAAAGAGGACTTATTGTTGTCATGGCCCATGAGATGATTGGAACTCAAATTGTTACTGAGAGCTTGGTGGCTCTGCTGGAAAGTGGAACGGAAA

AAGTGCTGCTAATTGATAGCCGACCATTTGTGGAATACAATACGTCTCACATTTTGGAAGCCATTAATATCAACTGCTCCAAACTGATGAAGCGAAGGTT

GCAACAGGACAAAGTATTAATTACAGAACTTATCCAACATTCTGCAAAGCATAAG GTTGACATTGACTGCAATCAGAAGGTGGTAGTTTATGATCAAAG

TTCCCAAGATGTTGGTTCTCTGTCGTCAGACTGCTTTCTCACTGTACTTCTGGGTAAACTGGAGAGGAGCTTCAACTCTGTCCACCTGCTTGCAG - UN

I28021 - GTGGCTTTGCTGAGTTCTCTCGTTGTTTCCCTGGCCTCTGTGAAGGAAAGTCCACTCTAGTCCCTACCTGCATATCTCAGCCTTGCTTACC

TGTTGCGAACATTGGGCCAACTCGAATTCTTCCCAATCTCTATCTTGGCTGCCAGCGAGATGTCCTCAACAAG - UNI2315 - GACCTGATGCAACA

GAATGGGATTGGCTATGTGTTAAATGCCAGCAATACCTGTCCAAAGCCTGACTTCATACCTGAATCTCACTTCCTGCGAGTGCCTGTGAATGACAGCTTT

TGTGAGAAAATCCTACCATGGTTGGACAAGTCTGTGGATTTCATTG - UNI24258 - AGAAAGCAAAAGCCTCCAATGGCTGTGTGCTTATCCACTG

CTTAGCTGGGATCTCTCGCTCCGCCACTATTGCTATTGCCTACATCATGAAGAGGATGGACATGTCTCTAGATGAGGCTTACAG ATTTGTGAAAGAAAA

AAGACCTACTATATCTCCGAATTTTAATTTTATGGGCCAACTCATGGACTATGAGAAGACGATTAATAACCAGACTGGAATGTCAGGGCCAAAGAGCAAA

CTGAAGCTGCTGCACCTAGACAAACCCAGTGAGCCCGTGCCTGCAGCCTCAGAGGGCGGATGGAAGAGTGCACTGTCTCTCAGTCCACCCTGTGCCAACT

CGACCTCGGAGGCATCAGGGCAAAGGCTTGTGCATCCTGCAAGTGTGCCCAGCTTACAGCCGTCACTCTTAGAGGACAGTCCGCTGGTACAGGCGCTCAG

TGGGCTCCAGCTGTCCTCAGAGAAGCTGGAAGACAGCACTAAGCTCAAGCGTTCCTTCTCTCTCGATATCAAATCTGTTTCATATTCAGCCAGTATGGCC

GCGTCCCTACACGGCTTCTCGTCAGAGGAGGCTTTAGACTACTACAAACCTTCTGCCACACTGGATGGGACCAACAAGCTCTGCCAGTTCTCCCCCGTTC

AGGAGGTATCAGAACAGAGTCCAGAGACCAGCCCGGATAAGGAGGAGGCCCACATCCCCAAGCAGCCCCAACCTCCCAGGCCTTCTGAGAGCCAGGTCAC

ACGCTTGCACTCAGTGAGAACCGGCAGTAGTGGGTCCACCCAGAGGCCCTTCTTCTCGCCACTGCATCGGAGCGGGAGTGTAGAGGACAATTACCATACC

AACTTCCTTTTTGGCCTTTCCACCAGCCAGCAACACCTCACCAAGTCTGCAGGGCTTGGCCTCAAGGGCTGGCACTCAGATATTCTGGCTCCCCAGTCCT

CTGCCCCCTCCCTGACCAGCAGTTGGTATTTTGCTACGGAGCCTTCACACTTGTACTCTGCTTCAGCCATCTATGGAGGCAACAGCAGTTACTCTGCCTA

CAGCTGTGGCCAGCTGCCCACTTGCAGTGACCAAATCTATTCTGTTCGTAGGCGGCAGAAGCCTACTGACAGAGCTGACTCGAGGCGGAGCTGGCATGAA

GAGAGCCCCTTTGAAAAGCAGTTTAAACGCAGAAGCTGCCAAATGGAATTTGGAGAGAGCATTATGTCGGAGAACAGGTCCAGGGAGGAGCTGGGCAAGG

TGGGCAGCCAGTCCAGCTTCTCCGGCAGCATGGAGATCATCGAGGTCTCTTGAGAAGACCTCGTCGCTTCTGTTGACAGTTTTGTTTCCTGTTCACAAAA

AATAGTCCCTGTAAATCTGAAATATGTATATGTACATACATATATATTTTTGGAATATAGAGCTACGGTATAAAAGCAACAGATGGATCAACACAGTTGT

TCTCTCAGCACCTGCACTGAGAATAGCTAACTCTCAGAAAAGATTGGAAGGGTAGATGTTAGAATTCTCCCAGCCAGGAGAAGAGATTTGGTTCAGTGAA

TTGCACATCTTCTTGTTCCTACAAAAGCAAGGGTTTTGTTTGTTTGTATGTTGTTTGTTTTTAATGTTAGAGGGCAAAATCCCTCCCATTTTCACGTGCA

ACAGAGGTCTCAGAACTCATCTCTGTCCAGGCCCTTCCCTAGTGCACCTTAGCGCTAAGACTGAGCCAGCTGTGGGTCAGGTGGGAAGACCCTCCCTCTA

ATGGTAACTCCAAGGGAAATGATCCTGTCTTAAGCTGCGTAATAAACCCAAACTTGATTGACAGCTGAAGGATACGGACATCATTCTGCTGGATGAACTA

TTTAGGAGCCTTGCCTAGATCTACTTATAACCAATCCAGTACCTCAGACAAGACATTTGGGGCCATCACCACTACCATGTCTAGTAGACCATTTTCTAGG

CATTGTGAATAAGTAGGTAACTTGTCACTTTCCAGACTATGCACAAAATCCCAGTGGGCCTGTTGCCCATGTAACCCTCCTGTCAGCTTGAATGAAGAGG

GGAAACCAACTAGAGTTTAGCTTCGCCAGAGATTGGGCAGTCAGATAGCTTAGAGACTTAAGCCAGGGATGGAACACTGAACAGTCTCCCTCCCTCCCTC

CCTCCCTGTAACATAAGAATTCTCTTTAGTGGGATTGTTACTTCTTCACTTGGCCACAGACCTGGTTTAGAGATAAGCATGAATCACTGGGCTTGGTAGC

AGACCGACAGAACCTCAGGTTCTCACTTCTGTTTCGTGTCCTGGAATAAAACTATGGCAAGACTTGGGAAGGTAAAACCTGAAGCAGGAAATGGATTTCC

TTGGCTTTTTTTCTCTATGGTATGCAACGAGGGTAATATTTCTAGAATCTTCTTAAACTTCCAAACTTAACCATGGGCTTTGGTAAGCAAGAACTAGTCA

GAATAAAACATACTAGAAAGGTTAAGAGGGCGTTGTTGAATTTTGTTTAGTTTTGAATACAGGAAAGCTCTTTTCCAAAGCTATCCCAGCATGCTTTCCA

GGGAAGGGGCATATCAGAGGGAAGGACCACAGTGGTGTCTTGGTCCCTGACATACAATCACTGTGTAGACTCAATCCTGGCAGCTGAGGATAGGAGATAA

GAACAAGAAGTGTGTACACGATAGTCCATATCTGCCCTTAAACTTCCTGGCTTGAGTTGTATCCTCTAGAGTACGGTCCTCCTTACGGCCTTAATTCACT

CACGTCAGCAGGGTGTGGGTGTGGGGTAGATGTTGTCATTGTTCTTTACTGTAAGTGTAGCTAGGGGCTGACTCATATCTCAGGTTTTTCTGTTAGTGAA

ATGGATGGTCCTTTGGCTAGGATGTGACTTACTGTTTCCTATACTGATTGCTGAAACCAGCATAGAGTGACGGTGGTTGGAAGCTGACAGGCTTGATTGT

GAGGAGGATTAGGGGCCTCGTGAACAGACTGGGTCTGTACAGATAAGCTGTGTGTGGGCATAAGGTGAAGGTAGAGCAGATACTGCACAGGGAGCACGTT

GCCACTCTTGGAGATTCTGTTCAGCAATCTTCTTAGATATATATCAAAATGTCTAAAGTTCTCAAAGCTTCACAGTAAATTTTGATACATTGTGTACACA

CACTTAAGTATGTAACAATCCACCTTCTTAAAATCTGGTCACACCGGTAAGATGTAATTTATTTAAGAATGAAAACAACGGCTCCAACATGAAGTATGTT

CCAGAAGACTGGGGACTTGGCTTCAGTAGCTTCGGGCAGTGCGTTACCTAATGCCAGATGTCCTGTAGAGAAGTGCTCTCTGGACTGTGTGGCTGACAGT

CATACACTACAGCTGTCAGTCCTTCGTCACTAATGTCGTATCAGTTCTTGGAATCACGACTACCATGCTGAAAGGGCTGCCTCTGAGGCACATTGTGGGT

GGTGGTGGTTAGGTCTCCTCACGTAAGCACAGGGAAGTCTGTGAAGTCTACTGGGATGGTACAAAATGGACTCTGTGAGAAATGCTGGAAACCGTTCAGG

CCGTTTATAAAGTTAGAGTGGAAAGACTATATAAATGTTTAATATGAATATCGTGTCCTTGAGTAAAAGGCAAGCTGTTGAATGGTTCACTTGTGCATCT

CTCATTCTCAAGTGTCACGTATGTTAATATGATGAAATAAAATCAGAACTGGTACCTATTTGT
Translation
 - UNI18124 - MAHEMIGTQIVTESLVALLESGTEKVLLIDSRPFVEYNTSHILEAININCSKLMKRRLQQDKVLITELIQHSAKHK VDIDCNQKV

VVYDQSSQDVGSLSSDCFLTVLLGKLERSFNSVHLLAG - UNI28021 - GGFAEFSRCFPGLCEGKSTLVPTCISQPCLPVANIGPTRILPNLYLGC

QRDVLNK - UNI2315 - DLMQQNGIGYVLNASNTCPKPDFIPESHFLRVPVNDSFCEKILPWLDKSVDFIE - UNI24258 - EKAKASNGCVLI

HCLAGISRSATIAIAYIMKRMDMSLDEAYR RFVKEKRPTISPNFNFMGQLMDYEKTINNQTGMSGPKSKLKLLHLDKPSEPVPAASEGGWKSALSLSPP

CANSTSEASGQRLVHPASVPSLQPSLLEDSPLVQALSGLQLSSEKLEDSTKLKRSFSLDIKSVSYSASMAASLHGFSSEEALDYYKPSATLDGTNKLCQF

SPVQEVSEQSPETSPDKEEAHIPKQPQPPRPSESQVTRLHSVRTGSSGSTQRPFFSPLHRSGSVEDNYHTNFLFGLSTSQQHLTKSAGLGLKGWHSDILA

PQSSAPSLTSSWYFATEPSHLYSASAIYGGNSSYSAYSCGQLPTCSDQIYSVRRRQKPTDRADSRRSWHEESPFEKQFKRRSCQMEFGESIMSENRSREE

LGKVGSQSSFSGSMEIIEVS
Transcript ENSMUST00000065273
Sequence
CTCTCTCCCCAACCCCCACACTACCCCCCCTGGTCCCCTCCTGCGGGCATCACCGTTTGGGGGGGCTCTCATCCCGTTTCCAACCATTTACCCTCCCCCT

CTCGCTTTTCCCGCGCGGACCCCCAACTTTACCTCAACTTCTTCATCCCTGTCGACATTTTTTTTTCCCTCTTTCGGGGGGCGGTGGAAGAGAAAGTGAA

GAAAAGTTGCAAACGCCCGGGCTCTCGCTAAGCTCTCCGCCCACCCTTCAGAGGAGAAGCCCCGGCGGCGAGGAGGACGCGCGAGCGACGGCTGGGCGAC

GCGGTGACAACGCTCGCTCCCCTCCGCGAGCCTGGAGCCGGCGGCCCCTCAA - UNI18124 - GTTGTCAGCCCAGTGTAAAGCTGTTGGAGTGAGG

GCAGAAAGGTAAAGGATGATGTAATGCCTGGCTGCCCTAGAGCATCTTTTGTTGTGGGATGGGTATTCCCATCATCTCTATGAATCTAGTGTGAGGGGCT

GCTTTGTGGAAGGAATCCTTTGCAAGAGCATATCAACAGGAAAGAGAAAGAGACATTCAGTTGGAGGGCTCTTGCTGAAATGGATTTAACTCTCCTCTTG

CCAGTCACCACTAGCCTGACCTCATACATTTTTAGTACAATGGAGTGGCTGAGCCTTTGAGCACAGCACCATTACATCATCGTGGCAAATTAAAGAACGA

GGTGGGGAAAGAGGACTTATTGTTGTCATGGCCCATGAGATGATTGGAACTCAAATTGTTACTGAGAGCTTGGTGGCTCTGCTGGAAAGTGGAACGGAAA

AAGTGCTGCTAATTGATAGCCGACCATTTGTGGAATACAATACGTCTCACATTTTGGAAGCCATTAATATCAACTGCTCCAAACTGATGAAGCGAAGGTT

GCAACAGGACAAAGTATTAATTACAGAACTTATCCAACATTCTGCAAAGCATAAG GTTGACATTGACTGCAATCAGAAGGTGGTAGTTTATGATCAAAG

TTCCCAAGATGTTGGTTCTCTGTCGTCAGACTGCTTTCTCACTGTACTTCTGGGTAAACTGGAGAGGAGCTTCAACTCTGTCCACCTGCTTGCAG - UN

I2315 - - UNI24258 - - UNI28021 - ACCTGATGCAACAGAATGGGATTGGCTATGTGTTAAATGCCAGCAATACCTGTCCAAAGCCTGACT

TCATACCTGAATCTCACTTCCTGCGAGTGCCTGTGAATGACAGCTTTTGTGAGAAAATCCTACCATGGTTGGACAAGTCTGTGGATTTCATTG - UNI2

4258 - AGAAAGCAAAAGCCTCCAATGGCTGTGTGCTTATCCACTGCTTAGCTGGGATCTCTCGCTCCGCCACTATTGCTATTGCCTACATCATGAAGA

GGATGGACATGTCTCTAGATGAGGCTTACAG ATTTGTGAAAGAAAAAAGACCTACTATATCTCCGAATTTTAATTTTATGGGCCAACTCATGGACTATG

AGAAGACGATTAATAACCAGACTGGAATGTCAGGGCCAAAGAGCAAACTGAAGCTGCTGCACCTAGACAAACCCAGTGAGCCCGTGCCTGCAGCCTCAGA

GGGCGGATGGAAGAGTGCACTGTCTCTCAGTCCACCCTGTGCCAACTCGACCTCGGAGGCATCAGGGCAAAGGCTTGTGCATCCTGCAAGTGTGCCCAGC

TTACAGCCGTCACTCTTAGAGGACAGTCCGCTGGTACAGGCGCTCAGTGGGCTCCAGCTGTCCTCAGAGAAGCTGGAAGACAGCACTAAGCTCAAGCGTT

CCTTCTCTCTCGATATCAAATCTGTTTCATATTCAGCCAGTATGGCCGCGTCCCTACACGGCTTCTCGTCAGAGGAGGCTTTAGACTACTACAAACCTTC

TGCCACACTGGATGGGACCAACAAGCTCTGCCAGTTCTCCCCCGTTCAGGAGGTATCAGAACAGAGTCCAGAGACCAGCCCGGATAAGGAGGAGGCCCAC

ATCCCCAAGCAGCCCCAACCTCCCAGGCCTTCTGAGAGCCAGGTCACACGCTTGCACTCAGTGAGAACCGGCAGTAGTGGGTCCACCCAGAGGCCCTTCT

TCTCGCCACTGCATCGGAGCGGGAGTGTAGAGGACAATTACCATACCAACTTCCTTTTT CCTTTCCACCAGCCAGCAACACCTCACCAAGTCTGCAGGG

CTTGG CTCAAGGGCTGGCACTCAGATATTCTGGCTCCCCAGTCCTCTGCCCCCTCCCTGACCAGCAGTTGGTATTTTGCTACGGAGCCTTCACACTTGT

ACTCTGCTTCAGCCATCTATGGAGGCAACAGCAGTTACTCTGCCTACAGCTGTGGCCAGCTGCCCACTTGCAGTGACCAAATCTATTCTGTTCGTAGGCG

GCAGAAGCCTACTGACAGAGCTGACTCGAGGCGGAGC GGCATGAAGAGAGCCCCTTTGAAAAGCAGTTTAAACGCAGAAGCTGCCAAATGGAATTTGGA

GAGAGCATTATGTCGGAGAACAGGTCCAGGGAGGAGCTGGGCAAGGTGGGCAGCCAGTCCAGCTTCTCCGGCAGCATGGAGATCATCGAGGTCTCTTGAG

AAGACCTCGTCGCTTCTGTTGACAGTTTTGTTTCCTGTTCACAAAAAATAG
Translation
 - UNI18124 - MAHEMIGTQIVTESLVALLESGTEKVLLIDSRPFVEYNTSHILEAININCSKLMKRRLQQDKVLITELIQHSAKHK VDIDCNQKV

VVYDQSSQDVGSLSSDCFLTVLLGKLERSFNSVHLLAD - UNI2315 - - UNI24258 - - UNI28021 - DLMQQNGIGYVLNASNTCPKPDF

IPESHFLRVPVNDSFCEKILPWLDKSVDFIE - UNI24258 - EKAKASNGCVLIHCLAGISRSATIAIAYIMKRMDMSLDEAYR RFVKEKRPTISP

NFNFMGQLMDYEKTINNQTGMSGPKSKLKLLHLDKPSEPVPAASEGGWKSALSLSPPCANSTSEASGQRLVHPASVPSLQPSLLEDSPLVQALSGLQLSS

EKLEDSTKLKRSFSLDIKSVSYSASMAASLHGFSSEEALDYYKPSATLDGTNKLCQFSPVQEVSEQSPETSPDKEEAHIPKQPQPPRPSESQVTRLHSVR

TGSSGSTQRPFFSPLHRSGSVEDNYHTNFLF PFHQPATPHQVCRAW LKGWHSDILAPQSSAPSLTSSWYFATEPSHLYSASAIYGGNSSYSAYSCGQL

PTCSDQIYSVRRRQKPTDRADSRRS GMKRAPLKSSLNAEAAKWNLERALCRRTGPGRSWARWAASPASPAAWRSSRSLEKTSSLLLTVLFPVHKK
Transcript ENSMUST00000081261
Sequence
CTCTCTCCCCAACCCCCACACTACCCCCCCTGGTCCCCTCCTGCGGGCATCACCGTTTGGGGGGGCTCTCATCCCGTTTCCAACCATTTACCCTCCCCCT

CTCGCTTTTCCCGCGCGGACCCCCAACTTTACCTCAACTTCTTCATCCCTGTCGACATTTTTTTTTCCCTCTTTCGGGGGGCGGTGGAAGAGAAAGTGAA

GAAAAGTTGCAAACGCCCGGGCTCTCGCTAAGCTCTCCGCCCACCCTTCAGAGGAGAAGCCCCGGCGGCGAGGAGGACGCGCGAGCGACGGCTGGGCGAC

GCGGTGACAACGCTCGCTCCCCTCCGCGAGCCTGGAGCCGGCGGCCCCTCAA - UNI18124 - GTTGTCAGCCCAGTGTAAAGCTGTTGGAGTGAGG

GCAGAAAGGTAAAGGATGATGTAATGCCTGGCTGCCCTAGAGCATCTTTTGTTGTGGGATGGGTATTCCCATCATCTCTATGAATCTAGTGTGAGGGGCT

GCTTTGTGGAAGGAATCCTTTGCAAGAGCATATCAACAGGAAAGAGAAAGAGACATTCAGTTGGAGGGCTCTTGCTGAAATGGATTTAACTCTCCTCTTG

CCAGTCACCACTAGCCTGACCTCATACATTTTTAGTACAATGGAGTGGCTGAGCCTTTGAGCACAGCACCATTACATCATCGTGGCAAATTAAAGAACGA

GGTGGGGAAAGAGGACTTATTGTTGTCATGGCCCATGAGATGATTGGAACTCAAATTGTTACTGAGAGCTTGGTGGCTCTGCTGGAAAGTGGAACGGAAA

AAGTGCTGCTAATTGATAGCCGACCATTTGTGGAATACAATACGTCTCACATTTTGGAAGCCATTAATATCAACTGCTCCAAACTGATGAAGCGAAGGTT

GCAACAGGACAAAGTATTAATTACAGAACTTATCCAACATTCTGCAAAGCATAAG GTTGACATTGACTGCAATCAGAAGGTGGTAGTTTATGATCAAAG

TTCCCAAGATGTTGGTTCTCTGTCGTCAGACTGCTTTCTCACTGTACTTCTGGGTAAACTGGAGAGGAGCTTCAACTCTGTCCACCTGCTTGCAG - UN

I28021 - GTGGCTTTGCTGAGTTCTCTCGTTGTTTCCCTGGCCTCTGTGAAGGAAAGTCCACTCTAGTCCCTACCTGCATATCTCAGCCTTGCTTACC

TGTTGCGAACATTGGGCCAACTCGAATTCTTCCCAATCTCTATCTTGGCTGCCAGCGAGATGTCCTCAACAAG - UNI2315 - GACCTGATGCAACA

GAATGGGATTGGCTATGTGTTAAATGCCAGCAATACCTGTCCAAAGCCTGACTTCATACCTGAATCTCACTTCCTGCGAGTGCCTGTGAATGACAGCTTT

TGTGAGAAAATCCTACCATGGTTGGACAAGTCTGTGGATTTCATTG - UNI24258 - AGAAAGCAAAAGCCTCCAATGGCTGTGTGCTTATCCACTG

CTTAGCTGGGATCTCTCGCTCCGCCACTATTGCTATTGCCTACATCATGAAGAGGATGGACATGTCTCTAGATGAGGCTTACAG ATTTGTGAAAGAAAA

AAGACCTACTATATCTCCGAATTTTAATTTTATGGGCCAACTCATGGACTATGAGAAGACGATTAATAACCAGACTGGAATGTCAGGGCCAAAGAGCAAA

CTGAAGCTGCTGCACCTAGACAAACCCAGTGAGCCCGTGCCTGCAGCCTCAGAGGGCGGATGGAAGAGTGCACTGTCTCTCAGTCCACCCTGTGCCAACT

CGACCTCGGAGGCATCAGGGCAAAGGCTTGTGCATCCTGCAAGTGTGCCCAGCTTACAGCCGTCACTCTTAGAGGACAGTCCGCTGGTACAGGCGCTCAG

TGGGCTCCAGCTGTCCTCAGAGAAGCTGGAAGACAGCACTAAGCTCAAGCGTTCCTTCTCTCTCGATATCAAATCTGTTTCATATTCAGCCAGTATGGCC

GCGTCCCTACACGGCTTCTCGTCAGAGGAGGCTTTAGACTACTACAAACCTTCTGCCACACTGGATGGGACCAACAAGCTCTGCCAGTTCTCCCCCGTTC

AGGAGGTATCAGAACAGAGTCCAGAGACCAGCCCGGATAAGGAGGAGGCCCACATCCCCAAGCAGCCCCAACCTCCCAGGCCTTCTGAGAGCCAGGTCAC

ACGCTTGCACTCAGTGAGAACCGGCAGTAGTGGGTCCACCCAGAGGCCCTTCTTCTCGCCACTGCATCGGAGCGGGAGTGTAGAGGACAATTACCATACC

AACTTCCTTTTT CCTTTCCACCAGCCAGCAACACCTCACCAAGTCTGCAGGGCTTGG CTCAAGGGCTGGCACTCAGATATTCTGGCTCCCCAGTCCTC

TGCCCCCTCCCTGACCAGCAGTTGGTATTTTGCTACGGAGCCTTCACACTTGTACTCTGCTTCAGCCATCTATGGAGGCAACAGCAGTTACTCTGCCTAC

AGCTGTGGCCAGCTGCCCACTTGCAGTGACCAAATCTATTCTGTTCGTAGGCGGCAGAAGCCTACTGACAGAGCTGACTCGAGGCGGAGC GGCATGAAG

AGAGCCCCTTTGAAAAGCAGTTTAAACGCAGAAGCTGCCAAATGGAATTTGGAGAGAGCATTATGTCGGAGAACAGGTCCAGGGAGGAGCTGGGCAAGGT

GGGCAGCCAGTCCAGCTTCTCCGGCAGCATGGAGATCATCGAGGTCTCTTGAGAAGACCTCGTCGCTTCTGTTGACAGTTTTGTTTCCTGTTCACAAAAA

ATAG
Translation
 - UNI18124 - MAHEMIGTQIVTESLVALLESGTEKVLLIDSRPFVEYNTSHILEAININCSKLMKRRLQQDKVLITELIQHSAKHK VDIDCNQKV

VVYDQSSQDVGSLSSDCFLTVLLGKLERSFNSVHLLAG - UNI28021 - GGFAEFSRCFPGLCEGKSTLVPTCISQPCLPVANIGPTRILPNLYLGC

QRDVLNK - UNI2315 - DLMQQNGIGYVLNASNTCPKPDFIPESHFLRVPVNDSFCEKILPWLDKSVDFIE - UNI24258 - EKAKASNGCVLI

HCLAGISRSATIAIAYIMKRMDMSLDEAYR RFVKEKRPTISPNFNFMGQLMDYEKTINNQTGMSGPKSKLKLLHLDKPSEPVPAASEGGWKSALSLSPP

CANSTSEASGQRLVHPASVPSLQPSLLEDSPLVQALSGLQLSSEKLEDSTKLKRSFSLDIKSVSYSASMAASLHGFSSEEALDYYKPSATLDGTNKLCQF

SPVQEVSEQSPETSPDKEEAHIPKQPQPPRPSESQVTRLHSVRTGSSGSTQRPFFSPLHRSGSVEDNYHTNFLF PFHQPATPHQVCRAW LKGWHSDIL

APQSSAPSLTSSWYFATEPSHLYSASAIYGGNSSYSAYSCGQLPTCSDQIYSVRRRQKPTDRADSRRS GMKRAPLKSSLNAEAAKWNLERALCRRTGPG

RSWARWAASPASPAAWRSSRSLEKTSSLLLTVLFPVHKK

For any suggestions or comments, please send an email to unitrap@crg.es