Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030208 (Emp1)
Chromosomal location
Chr 6: 135312949 - 135333191 (+)
Description
epithelial membrane protein 1 Gene [Source:MGI (curated);Acc:Emp1-001]
RefSeq_dna
NM_010128 
RefSeq_peptide
NP_034258.1 
UniGene
Mm.182785 Mm.471000 
MGI
MGI:107941 
Uniprot/SWISSPROT
P47801 
Uniprot/SPTREMBL
Q05BR0 Q3UXM2 Q4FK43 
Human Ortholog
ENSG00000134531 (EMP1)
Omim not available
UniTrap UNI22747
Vector Insertion
Chr 6: 135327195 - 135327307
Public Clones not available
Private Clones OST285746 (lexicon) OST215542 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111907
Sequence
GGGATGAGGAGGTGGCTTCTGCTGCCCTACCTGATCCAAGAGTCCTTGGGCACAGTATTAAAGAACTCACCTGAAATAGCCCTGGATATTACCCGAGCTT

GGAAAGAAGGAAGATGTTTGGCTTATCAAACAAAGGGTGCCATCTCCGGAGGAGTCTGTGCACACATCAGTTCACTAGGAGCATAACTGGGCTCAGAAAC

TGAGCTGGTCCTGG - UNI22747 - AATTCTCTACTCAGAAGTCACCAAAAAGCCAAGATGTTGGTGCTACTGGCTGGTCTCTTTGTGGTCCACATT

GCCACTGCCATTATGCTGTTTGTCTCCACCATTGCCAAC - UNI22747 - GTCTGGATGGTTGCAGATTACGCAAATGCATCTGTAGGGCTTTGGAA

GAACTGCACTGGTGGTAACTGCGACGGCTCCCTGTCCTACGGCAATGAAG ATGCTATCAAGGCAGTGCAAGCCTTCATGATCCTCTCCATCATCTTCTC

CATCATCTCCCTTGTGGTCTTCGTGTTCCAGCTCTTCACTATGGAGAAGGGAAACCGGTTCTTCCTCTCAGGGTCCACCATGCTGGTGTGCT GGCTGTG

TATCCTGGTTGGAGTGTCAATCTACACTCATCATTACGCCCACAGCGAAGGGAACTTCAACTCCAGCAGCCACCAAGGCTATTGTTTCATCCTGACCTGG

ATCTGCTTCTGTTTCAGCTTCATCATCGGCATACTCTATATGGTCCTGAGGAAGAAATAAGCCGAATACGCTCATGGGCGTCTGGGGGCGGGGTGGGCTG

GGTAGGAGGAAGCAACCTAACCTGGGAGGGAAGCAGGAGTCACTGTGTAGGAATAACAGAGAGGGGAGGGGGGTGGGGAGAGGGAAGGAAGAGGGGGAGA

GGCCCAAACCCAAACCATATCTGGGGCGGTGGGATTCTCTACTGCCAAGCACCCATCCTTGGAAGAAAGTTGTTGGCTGATATGCTGATGCTTCCTTGAC

GTCACCAGAGAGTCCTCCTCTAGCCACCAAATATGGCCCCGTCCATCCTCAATTACATACACTCGGGGCCTCCCCAGCTGCCATACCACTGGCGCCACTC

TTGAGGGTGGCTGCTGGGTCACACACTGAGGTCTTCCACATCCATATTATCAAGTTCTGATGGTGGTTCAGGTCTTAGCAAGAGCAGATATTGCTCTATG

CTGAGGCTAAGTCTGGAAGCCACTTTGTCCTTGTGACCTAAAAACAAACATCAAATCCAGATCCCATGTGCCTGTAGTGGGAGCTTTGGCCAGGAAGCCA

ATGTGCATATTTGGTGGCCTTTCTAACAAAAGTATAGGAAGAGAGATGGTTTGTAAGTTCAAGCTGATGGAATTGGTTTAGCCAAGAAATGGAAGTTTCT

ACCCCAGAGGATCTTGGAGACAGGTGGGGACAGGCAGTGCTCCTCAGTCACGTGTCACCGAGCTGTCCCACATGGAGGCCTCCTATTGTGAACTTTGCTA

GACTCTCACTTACAGCCAAGGCAGCTTTTCTGGAGTTTTTCTAGATTCTCTAGAGCCAAAGATGATAATGCCTCACAAAACATAGGGTCAAAGCATATGC

CCACCGCAGTGCTATAGTAAGTTTGTGGGTTTTTAGGATTCCCCCAAAGCACTCAATGTATCTTGTATATGTAACAGGGGAGAAATGCATGTGTTCCTTT

GACATACAATTCTGAACTAGGAATATTTGAGGAAGTCCAATGATGACCAACAACACTGGGGACCAGAATATAACATCTAAATGCAGTAGTCACTATTGCT

TTGACCTGGGCTGGAGTGGTCTCCTCTCAACAGCTTTCATCACACTATTTTCCAGCTAAAGATGGCAAAGCTGTAAGCCAATTAACATATACACCAACCT

AAACTAAAGAACCAGTCCTGAGGGTGTGAGAAAGGTGCTATCTGGTTATGGATTATTAAGCAAACCGTATTTCATTTATGTTGAGAAGAGAATGCCTGCC

CTCAGGGAAAAAAATGTCATTGTGTGAGATGAATAAAGTCCTGGTGATGGGCAGACAGTTTCTCTTTTAAAACAGGAGAAACTCTTAGGGCATCCAGACA

GATGGTAGCTAAATTGTTGGGGCTGCAGGGGTATTCCTGTATAAGACTTAGAGGTAGTATGATATCTCAGATTTCTGCCTTAAAGGGCTTTCTTTTTAGA

AATAGTTTCTTTTATTGCCCTTAGAAGATCACCCCCAGGAAGAGTATGAGCTATCTTTTCTACATTTCTTTTCCTAGGAATATTCTTATCCATTTCTTAT

ATACATTTCTTTTGGGAGGGAGTTTTTATGCTATAGTTGCTGGTATTTATGTAAAGGGACCATTACTAAGTGTATTTCTCTAGCATATTATGTTTAAGGG

ACTGTTCAAGGTAGGTTACTGAACTGCCGGGCTGATGTTAGAGACACTGGCCAGAAAAGCTATAATAAGTTCTTAAATTATAATTTGATCACTATACATT

TGTTCTATGCTGCCTTATGTTCATAAGAATATCAACAGACAGCTAGAGCCAGAAAAAGATAGTCACATTTTGTTAAAAAGTTGAATTATGACTGGAGTGA

ACCGTGCATTCCCTTGCCTTTTACTTTTTTTCTGTGACATTTACGTCTCATGTAATTTGCATCGCATTGGTGGGTTATTCTAGTACTGTATTTGGCTTCT

TCATTAATAGGATATTTCACATACTATAATTGTAAATATTTTGATACAAATGTTTATAACTCTAGGGATATAAAAACAAATTCTGATTCCCTA
Translation
 - UNI22747 - MLVLLAGLFVVHIATAIMLFVSTIAN - UNI22747 - VWMVADYANASVGLWKNCTGGNCDGSLSYGNED DAIKAVQAFMIL

SIIFSIISLVVFVFQLFTMEKGNRFFLSGSTMLVCW WLCILVGVSIYTHHYAHSEGNFNSSSHQGYCFILTWICFCFSFIIGILYMVLRKK
Transcript ENSMUST00000032330
Sequence
ACGGGGAAAAGAAACCGCCCATCACACACCCCAGCACATCAGCCCAGGAAACTTATAACCTCGGGAGTCAGGTCCCTCCCCTCACTGTGGTTGCAAATCT

CCTGAAGAGAGGACCAGACCAGCAGCCTGCTCTACCACCCAGGGCATCTGCCTCTCTCACTGGATACTCCAG - UNI22747 - AATTCTCTACTCAG

AAGTCACCAAAAAGCCAAGATGTTGGTGCTACTGGCTGGTCTCTTTGTGGTCCACATTGCCACTGCCATTATGCTGTTTGTCTCCACCATTGCCAAC - 

UNI22747 - GTCTGGATGGTTGCAGATTACGCAAATGCATCTGTAGGGCTTTGGAAGAACTGCACTGGTGGTAACTGCGACGGCTCCCTGTCCTACGG

CAATGAAG ATGCTATCAAGGCAGTGCAAGCCTTCATGATCCTCTCCATCATCTTCTCCATCATCTCCCTTGTGGTCTTCGTGTTCCAGCTCTTCACTAT

GGAGAAGGGAAACCGGTTCTTCCTCTCAGGGTCCACCATGCTGGTGTGCT GGCTGTGTATCCTGGTTGGAGTGTCAATCTACACTCATCATTACGCCCA

CAGCGAAGGGAACTTCAACTCCAGCAGCCACCAAGGCTATTGTTTCATCCTGACCTGGATCTGCTTCTGTTTCAGCTTCATCATCGGCATACTCTATATG

GTCCTGAGGAAGAAATAAGCCGAATACGCTCATGGGCGTCTGGGGGCGGGGTGGGCTGGGTAGGAGGAAGCAACCTAACCTGGGAGGGAAGCAGGAGTCA

CTGTGTAGGAATAACAGAGAGGGGAGGGGGGTGGGGAGAGGGAAGGAAGAGGGGGAGAGGCCCAAACCCAAACCATATCTGGGGCGGTGGGATTCTCTAC

TGCCAAGCACCCATCCTTGGAAGAAAGTTGTTGGCTGATATGCTGATGCTTCCTTGACGTCACCAGAGAGTCCTCCTCTAGCCACCAAATATGGCCCCGT

CCATCCTCAATTACATACACTCGGGGCCTCCCCAGCTGCCATACCACTGGCGCCACTCTTGAGGGTGGCTGCTGGGTCACACACTGAGGTCTTCCACATC

CATATTATCAAGTTCTGATGGTGGTTCAGGTCTTAGCAAGAGCAGATATTGCTCTATGCTGAGGCTAAGTCTGGAAGCCACTTTGTCCTTGTGACCTAAA

AACAAACATCAAATCCAGATCCCATGTGCCTGTAGTGGGAGCTTTGGCCAGGAAGCCAATGTGCATATTTGGTGGCCTTTCTAACAAAAGTATAGGAAGA

GAGATGGTTTGTAAGTTCAAGCTGATGGAATTGGTTTAGCCAAGAAATGGAAGTTTCTACCCCAGAGGATCTTGGAGACAGGTGGGGACAGGCAGTGCTC

CTCAGTCACGTGTCACCGAGCTGTCCCACATGGAGGCCTCCTATTGTGAACTTTGCTAGACTCTCACTTACAGCCAAGGCAGCTTTTCTGGAGTTTTTCT

AGATTCTCTAGAGCCAAAGATGATAATGCCTCACAAAACATAGGGTCAAAGCATATGCCCACCGCAGTGCTATAGTAAGTTTGTGGGTTTTTAGGATTCC

CCCAAAGCACTCAATGTATCTTGTATATGTAACAGGGGAGAAATGCATGTGTTCCTTTGACATACAATTCTGAACTAGGAATATTTGAGGAAGTCCAATG

ATGACCAACAACACTGGGGACCAGAATATAACATCTAAATGCAGTAGTCACTATTGCTTTGACCTGGGCTGGAGTGGTCTCCTCTCAACAGCTTTCATCA

CACTATTTTCCAGCTAAAGATGGCAAAGCTGTAAGCCAATTAACATATACACCAACCTAAACTAAAGAACCAGTCCTGAGGGTGTGAGAAAGGTGCTATC

TGGTTATGGATTATTAAGCAAACCGTATTTCATTTATGTTGAGAAGAGAATGCCTGCCCTCAGGGAAAAAAATGTCATTGTGTGAGATGAATAAAGTCCT

GGTGATGGGCAGACAGTTTCTCTTTTAAAACAGGAGAAACTCTTAGGGCATCCAGACAGATGGTAGCTAAATTGTTGGGGCTGCAGGGGTATTCCTGTAT

AAGACTTAGAGGTAGTATGATATCTCAGATTTCTGCCTTAAAGGGCTTTCTTTTTAGAAATAGTTTCTTTTATTGCCCTTAGAAGATCACCCCCAGGAAG

AGTATGAGCTATCTTTTCTACATTTCTTTTCCTAGGAATATTCTTATCCATTTCTTATATACATTTCTTTTGGGAGGGAGTTTTTATGCTATAGTTGCTG

GTATTTATGTAAAGGGACCATTACTAAGTGTATTTCTCTAGCATATTATGTTTAAGGGACTGTTCAAGGTAGGTTACTGAACTGCCGGGCTGATGTTAGA

GACACTGGCCAGAAAAGCTATAATAAGTTCTTAAATTATAATTTGATCACTATACATTTGTTCTATGCTGCCTTATGTTCATAAGAATATCAACAGACAG

CTAGAGCCAGAAAAAGATAGTCACATTTTGTTAAAAAGTTGAATTATGACTGGAGTGAACCGTGCATTCCCTTGCCTTTTACTTTTTTTCTGTGACATTT

ACGTCTCATGTAATTTGCATCGCATTGGTGGGTTATTCTAGTACTGTATTTGGCTTCTTCATTAATAGGATATTTCACATACTATAATTGTAAATATTTT

GATACAAATGTTTATAACTCTAGGGATATAAAAACAAATTCTGATTCCCT
Translation
 - UNI22747 - MLVLLAGLFVVHIATAIMLFVSTIAN - UNI22747 - VWMVADYANASVGLWKNCTGGNCDGSLSYGNED DAIKAVQAFMIL

SIIFSIISLVVFVFQLFTMEKGNRFFLSGSTMLVCW WLCILVGVSIYTHHYAHSEGNFNSSSHQGYCFILTWICFCFSFIIGILYMVLRKK

For any suggestions or comments, please send an email to unitrap@crg.es