Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030232 (Aebp2)
Chromosomal location
Chr 6: 140571184 - 140625939 (+)
Description
AE binding protein 2 Gene [Source:MGI Symbol;Acc:MGI:1338038]
RefSeq_dna
NM_178803 NM_009637 NM_001005605 
RefSeq_peptide
NP_848918.1 NP_033767.1 NP_001005605.1 
UniGene
Mm.86453 Mm.401473 Mm.470238 Mm.471626 
MGI
MGI:1338038 
Uniprot/SWISSPROT
Q9Z248 
Human Ortholog
ENSG00000139154 (AEBP2)
Omim not available
UniTrap UNI10858
Vector Insertion
Chr 6: 140572209 - 140572866
Public Clones D016E08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18591
Vector Insertion
Chr 6: 140582209 - 140582418
Public Clones not available
Private Clones OST420067 (lexicon) OST329967 (lexicon) OST307194 (lexicon) OST283910 (lexicon)
OST274269 (lexicon) OST264060 (lexicon) OST258615 (lexicon) OST252000 (lexicon)
OST240140 (lexicon) OST128040 (lexicon) OST100436 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7736
Vector Insertion
Chr 6: 140586289 - 140590692
Public Clones RRN059 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5673
Vector Insertion
Chr 6: 140590880 - 140592468
Public Clones CSI656 (baygenomics) W087A07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11591
Vector Insertion
Chr 6: 140596560 - 140596560
Public Clones P062A08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27916
Vector Insertion
Chr 6: 140604003 - 140625911
Public Clones CMHD-GT_542E12-3S (cmhd) CMHD-GT_542E12-3 (cmhd) CMHD-GT_542E12-5S (cmhd)
IST12381B2 (tigm) IST13745F2 (tigm) IST13120E3 (tigm) IST13083A7 (tigm)
Private Clones OST44145 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111845
Sequence
GCCGCCATGGCCGCCGCGCTCGCCGACATGGCCGACCTGGAGGAGCTCTCCCGCCTCAGCCCGCTGTCCCCCGGCAGCCCCGGGCCCGCGGCGCGCGGCC

GGGCCGAGCCGCCGGAGGAAGAGGAGGAGGAGGATGACGAGGAGGCGGAGGCAGAGGCGGTGGCCGCGCTGCTGTTGAACGGGGGAGCGGGCGGCGGCGC

GGGGGGCGGCGAGGCGGAGACCATGTCGGAGCCGAGCCCCGAGAGCGCCAGCCAGGCGGGCGGGGACGAGGACGAGGACGAGGAGGACGACGAGGACGAG

GGCAGCAGCAGCGGCGGCGCGGAGGAGGAGAGCAGCGCCGAGAGCCTGGTGGGCAGCAGCAGCGGCGGCTGCAGCGGCGACGAGACGCGCTCGCTGAGCC

CGGGCGCGGCGAGCAGCAGCAGCGGCGATGGGGACGGGAAGGAGGGCCTGGAGGAGCCCAAGGGACCGCGGGGCGGCCCGGGCGGCCCGGGCAGCAGCGG

TGGCGGTAGCAGCAGCAGTAGCGTGGTGTCGAGCGGCGGCGACGAGGGCTACGGCACCGGGGGAGGCGGGAGCAGCGCGACCTCCGGGGGCCGGCGGGGC

AGCCTGGAGATGTCGTCCGACGGGGAGCCGCTGAGCCGCATGGACTCGGAGGACAG - UNI10858 - - UNI18591 - CATAAGCAGTACGCTAA

TGGACATAGACAGCACAATTTCCAGTGGACGCTCAACCCCGGCCATGATGAATGGACAGGGGAGCACGACTGCTTCAAGCAAACACATTGCCTATAACTG

TTGCTGGGACCAGTGCCAGGCATGCTTCAACTCCAGCCCAGACCTGGCAGACCACATTCGCTCCATACATGTCGATGGTCAGCGTGGAGGG - UNI185

91 - GTGTTCGTTTGCTTGTGGAAAGGTTGCAAGGTGTATAACACCCCGTCAACCAGTCAGAGTTGGCTACAGCGGCACATGCTGACACACAGTGGAGA

CAAGCCTTTCAAG - UNI7736 - TGTGTAGTTGGTGGCTGCAATGCCAGCTTTGCTTCTCAGGGAGGGCTAGCTCGCCATGTACCCACACACTTCAG

TCAGCAGAACTCCTCAAAAGTTTCTAGCCAGCCAAAGGCCAAAGAAGAATCTCCTTCTAAAGCTGGAATGAACAAGCGGAGGAAACTAAAGAACAAAAGA

CGGCGCTCATTAC - UNI5673 - CGCGGCCACACGATTTCTTCGATGCACAAACACTGGATGCCATAAGACATCGAGCCATCTGCTTTAACCTCTCT

GCTCACATAGAAAGTCTAGGGAAGGGACACAGTGTTGTTTTCCACAGTACT GTAATAGCGAAGAGAAAGGAGGAATCTGGAAAGATAAAGCTTTTGCTT

CATTGGATGCCGGAAGACAT TCTGCCAGATGTATGGGTGAATGAGAGTGAACGACATCAGTTAAAAACGAAAGTAGTTCATTTATCAAAGCTACCCAAA

GATACTGCCTTGCTGTTGGACCCAAACATTTACAG AACAATGCCGCAGAAGAGGTTGAAGAGGTAAAACATTCATAAATACATAAAAGCAAACACGCGG

GGACACCTGCAGTCTTAGTCACTGACAATGGGCTTAGGGAAAGTTGCACATTACAGTCAACCCCTTCCTTCCTCCTTTACTTTAAGTCCAGTATTTAGAG

TACTATTTATGGCTAGTGTGGACATTCTGTGAGTGAAGGAGGTCTTCTGTGGAATATATTAATATATACTGCAGTCCACATGGCATGGAATGGCGCTGTG

GGAGACTGCGCAGACACTCTCTGGCAACTCAGTGGAACAGCTTCTGAAAAGGCTTTGCATGCTCGCTGCTTAAGCTGCTTTTTTTCTTCCCCCCTAGTGA

TTACAGTAGTTTTATTGGAGAGACAAACAATTGCCCTTAAAAACACCAAAAGCACTGTAAGATAACCATCTTGACAGTGTGTATTGATTTGAAGTCCTGA

TAGAAAATATTTAGACAGTGGAGATTATCAAAAGATAACTAACCTTTCAGTTATGATAAATAGATGTGATTGGTTGCCATTTGTGTTCTTTTGCAGAACT

CTGATAAGAAAAATGTTCAATTTGTATTTAAGCAAACAGTGAACGACATTTGCAATCAACTAAAAATTCGTCTATCGAATTAGGTCTGAGAATCACTGTT

AAAGAGTATTGCCGTGTGTCTGGTGGCTCCCTTTTCAGGACTAGGGTCTCTCTCTCTCTCTCATGGGGACAGCGTGTTAATATTTACCTACATAACTCTT

TTGTTAATGGTTTTTGAAAAAAACCTCAGTTTCAAATTATTTGAGTAATCTCCATATTTTCATTTAACCTCTGACTCTTTAATTTTTTTCCTGAGGAAAG

TGTTTTTTTTTTTAATTTTTTTTAATGTTAAAAAATTGTATTTTTTTTAAAAATATCTTCAAACTGAATCTTTTAAGCACCAAAGTTGGTTTTGAAAAGG

AAAATAAAATCACTTTCTTGCTTGGCAGGCAAGAAGCCATATGGAATTTTTTTAACTTTTACAGAAATGTGTAACTTGTCAGTACTGTATCAAACAAATG

TTGCATAGAGATAATAGAGCGTTGCTTGTAAATAATTCAGCAGATTTGTAATATATTTTTCTATTATGAAATGTACTGTAGATGTTTTCTAGAGGCATGA

AAGTCAATGTATATATTATGGTAGAAATAATATTGAAGGAAATTGTAATTCACTAGTGCTGCCAGAGGGATTGCTAACAAAGCACCTTTAGGAGAGATGT

CTGCAGACTGAAGGGACTGTGTACTACTGTTAATGTCTAAGAACAAAGCATTGGGCGGGCGTCCTTCCAGAAAGTCTCTGAGGGAGGACGGAGACCCATA

ATAGAAGTTTATGGCACTCCCTCTGACAGTGGCTGAGTCGCTGTTCCTTACTGTTGGGAGCGGTACCGTAAAGTAAGCGCCTGCTATGCAGTCAGGCTGC

AGAAAGCACTCCTTCCTTGGAGTCCTCACTCCCTACAGTGACAGCAATACCAGCAGTTTTTACTCTAAATTTTTTAAAGAATAGACAAATATAAATTTAA

TTCTTTGGTTCCAAAATGGGAAAGATTCCATGATACATAGATCATTTCTCATTTGCTTAAAAAAGAAAGACCACACGCACAAGGTCCTAAAAGGATGGGG

GGGCTTTAGCAGGTGAAGAGGTAGGCATGGAACAGTCATGGAGCCTGAGGGACGAGGGGGAAGCACTGCGGATGGGCACGCTCGCTCGGGAACGGTCGGC

TAAGACGCTCTGTAGCTAACAGGAGTCTATTTTCAGAAGAAGAAAGCAGTGTGTTTTTACTATGTTTTTCCTTTTGCTTAAGCACTTCATCACTTGTTTT

ATTCTGTATCTGCGAAGTACTCTCCGATCTCCTATGTTCCTTTAACATTTTGGTTTGTTAAAATATTGCCAAATAGAGTGTTTGAGACATATAGTTTGTA

CTAGTATTTTTATTTTACTTCTCATGTTCTTGTAAGTCATTAATTGACCGATGATTGTAGACCTTGCTTGAGTATTTTTTCTAATAAAACAAAGCAAATT

ATACTTAGCTTCAAATTGTAACAATTCAATTTAATTTTAGGATGACATCTGGAAATACACATTCAACATTTTCTTTAGGTGCATAGAGAACATTCATTAC

TGTCAATGTAGAAAATTTGTGATGTCAAACCATGCTGCTGGTTGTTGATTAGCCTCTGCGTGCCCAGGTATCCAGGGTCCCTTTGCTTGTCATTGACTTG

GGCTTGACACTTGTAAGTGAGCTAGTTTGGTAACTTGTGCGTGTGCATATCTACATATACATTCAAATGTGATTGGAAAGTTAAGTCTGTAACATCCATT

AATGTTTCTTCTTACCCAGCTCCGATCTTGCTCTGCCTGTCTGTATATGACATTTATGGTGGACCTGGGTTGTTTCTGCCCCAAATCCATGTCTGGACAG

TACAGACCATAGGCCCTGCTCTCATTTTCAGAGCTGTTGCTTGTCTTTTCCTGCCTATTGGAGTACTGAGACTTGAGGGGCCCGAGAGCCTGAGGTGTTA

CGTCTGCTCTATACAGAGGTGCTTACTCATATCATGTAGCTGGTAACATTTTTGGAGCAGTGAACACAGACCACACAGTTTGTACTCAATATGGCCATGT

TGATAGTAGTAGTGAGCACGGGGCTAGAGCTCCGAGAAGACGGTTTAATACACTTCACAGGAAGTGCTGCCACAGGCACCGAAGCACATGGCGTTTGGGT

GGAACTTTTCATTTAAATTTCTTAATATTGTTGAGGATCTACAATTTTCCCATGTGTGCTTTGTCTTTCAGGGATTGAATGAGAGTCTGTAAGTCAGACT

CTGTTACAACCACAAGGAACGTTTGTTCTAGCGAAAAGAATCTTGAAGTAGGAAATGTTGTAAAAATTTTAAATTCTTTATTTTTCTAGTAAACCTGTTC

ATACATTAATGTGGTTGCACATTAATTCTGAATTTCAGATGAAAAGAAAATAAAGTGGACAATACTTAACCCTCAAGTATTTTCACATGTGTCTATCTCA

TTGAACATAAAAAGCCGGGTGTGCTGACTAAAGCCCTGCATTTGGGAGGACGAAGCAAGAGGATTTCCAAGAGTTCAAGGCCCGAGTGATATCCTGAGGC

AAACAAACCAAAAAGGAAAGAAGAAATACTGATAATTAGAGTTTTTTTTCTCTGTGTCACACATTAGGGAAATAGGTGCCATTGAGGTGGCTCTCGATGA

AGGTGTTGGGCAACAGGCATGGTGGCCTGAGTTCCATGCCTGGGAGTCACGTGGTCTGAAGCGAGAACAGACCGGAGAATTGTCTTCCCCAACAAGTAAA

TGTGCAAATGATCTTCTGCAAAGGTAGAATTTGCCAGAGTTAAAAACATGGATGATCTGTTGTTTGCGTTGAACTGTTTTCTTGATGCATGGTTAACAAG

AGATGAGATAATATTGACTGAATATCAAAGTGGGTAAATGTGGTTGAAGCAGTGTAAATAGTTTGAGTAACAGCTTTACTTTTTTAATTTTTATAATACT

CCTGTATAAATCCTAAAGGCAAACCAAATTTTAGACGGTGTGGACTTCGAGTAGAAAGCCTGACACAGTGATGTGTCTGACAAGACCTCAGGTTGCAGAG

ATACATAAACATATGTGGTTTATTTGTAAAGAAAATTTCAAACCATATGTTATTTGGAAGTCTTTTTTAAAAAGCAGAGTGGCACTTTGTGAGGTTTTAA

TTTAAGATATTTTTCTATTCTATTTCATAAAAGGTTAAAAAGTTTGTGTATAAATATTTTTTTTAATTGTTCAAGAATCTTATGACCTGGTGTAGGGCAT

TTTGCAATTCTAACACTATAGCTTTAATATAAATAACATTTGTAGAGGTTTTCTTTGTAATAAAGGCGAGAATATTTTGTAATTTCTATTATTTCCTTTA

GAACCTGAATAACCTTAAATATAGGCATGAAATGTTGTATTATGACTTTTATATTGTTAAAATTTAAAAACAAAACTTATCCAACTTTATTTCTTTCCCA

AGTTAAGTTTGTAGTGTCACACGGGACTGTTAATCTGCAAAGAGGGTGTAAGCAGGCTAGAGCAGGTTTTTTCTAGGTCAGTTGCGTCTCAGAGATGAGC

AAGGTGATGATAGATGTGTTTAACCTCACTATGATGTCCTCACTGATGCCCCCGAAGGCCGCCAGGATTGTACTCCACACAAAATCACTGACAAAGTGTT

TGTCCTGTCAGTACGGTGCTGTGGGCAACTGCAGCGCAGGGGACACTGGGGGTTGAGCTTAGCAAGGGATGGTATCTGCCTTTACTGACAGACAGAATAA

AGGGACCTACGCGTGGGTACCCAAACCTCTCCAGTGCGAAGGATTGTTGATGTTATTTTTTATAATCTCAGTTGAAATGTAATTATTTGGATTTATTTAA

TCCTATTAAATATAGCTTGTTTTTGGAAGAACCCTCTAAGAACAGTAAGACCAATAAAATTGCTGTAAATGGCGTTTTCAGTAATTCTGTCCTCAGGACC

TGTCTGGCCTGTGGTTTCTCTAGAAGGCTGCAGAGCCTTGCTGTTCTCTGTTGTGTGTTCCTCAAGGTTGACATTCTCTGCCTGAAGAAAATGTGTCTTT

ACAAATTTTACAATTTTATAATGATTTCTATGTTTCTTGTAAAGGAATTGTTCACAAATTTA
Translation
 - UNI10858 - - UNI18591 - MDIDSTISSGRSTPAMMNGQGSTTASSKHIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGG - UNI185

91 - VFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFK - UNI7736 - CVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPKAKEESPSKA

GMNKRRKLKNKRRRSLP - UNI5673 - PRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHST VIAKRKEESGKIKLLLHWMPEDI ILP

DVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYR RTMPQKRLKR
Transcript ENSMUST00000032359
Sequence
GGAACTCGCTATATAGATCAGGCTGGCCTCGGAATCTCGGAGACCCTCCTGCCTCGGCCACCCTAGGGCTGGGGTTAAAGGTGTGCCTTTTAGGTGAGGT

ACCTGTGTGCACCACCCACCAGACTGGGAGGGAGGCCGGGAGATGTGGTCAGAGCTGCTGGGATTAGACAGTTGTGAGCCGCCTTGTGGGTGCTGCAAAC

CGACCGCCGGCTCCTCTGGAAGAGCGGTTAGAGCCCTCAACGGCCAGCGCTACACCCCAAGAACTCAGCCTGCCTACAAGTGTCACCCCAGATTTTATTA

GAAGCTCCAGGACTTAAAACCTGCGAGGATCTCGAGCCAAAGCAACGCCCGCCTCGTCTGAGCTGCCCTCCTTGGGTCATTGGGACATCGGGACAG - U

NI10858 - - UNI18591 - CATAAGCAGTACGCTAATGGACATAGACAGCACAATTTCCAGTGGACGCTCAACCCCGGCCATGATGAATGGACAGG

GGAGCACGACTGCTTCAAGCAAACACATTGCCTATAACTGTTGCTGGGACCAGTGCCAGGCATGCTTCAACTCCAGCCCAGACCTGGCAGACCACATTCG

CTCCATACATGTCGATGGTCAGCGTGGAGGG - UNI18591 - GTGTTCGTTTGCTTGTGGAAAGGTTGCAAGGTGTATAACACCCCGTCAACCAGTC

AGAGTTGGCTACAGCGGCACATGCTGACACACAGTGGAGACAAGCCTTTCAAG - UNI7736 - TGTGTAGTTGGTGGCTGCAATGCCAGCTTTGCTT

CTCAGGGAGGGCTAGCTCGCCATGTACCCACACACTTCAGTCAGCAGAACTCCTCAAAAGTTTCTAGCCAGCCAAAGGCCAAAGAAGAATCTCCTTCTAA

AGCTGGAATGAACAAGCGGAGGAAACTAAAGAACAAAAGACGGCGCTCATTAC - UNI5673 - CGCGGCCACACGATTTCTTCGATGCACAAACACT

GGATGCCATAAGACATCGAGCCATCTGCTTTAACCTCTCTGCTCACATAGAAAGTCTAGGGAAGGGACACAGTGTTGTTTTCCACAGTACT GTAATAGC

GAAGAGAAAGGAGGAATCTGGAAAGATAAAGCTTTTGCTTCATTGGATGCCGGAAGACAT TCTGCCAGATGTATGGGTGAATGAGAGTGAACGACATCA

GTTAAAAACGAAAGTAGTTCATTTATCAAAGCTACCCAAAGATACTGCCTTGCTGTTGGACCCAAACATTTACAG AACAATGCCGCAGAAGAGGTTGAA

GAGGTAAAACATTCATAAATACATAAAAGCAAACACGCGGGGACACCTGCAGTCTTAGTCACTGACAATGGGCTTAGGGAAAGTTGCACATTACAGTCAA

CCCCTTCCTTCCTCCTTTACTTTAAGTCCAGTATTTAGAGTACTATTTATGGCTAGTGTGGACATTCTGTGAGTGAAGGAGGTCTTCTGTGGAATATATT

AATATATACTGCAGTCCACATGGCATGGAATGGCGCTGTGGGAGACTGCGCAGACACTCTCTGGCAACTCAGTGGAACAGCTTCTGAAAAGGCTTTGCAT

GCTCGCTGCTTAAGCTGCTTTTTTTCTTCCCCCCTAGTGATTACAGTAGTTTTATTGGAGAGACAAACAATTGCCCTTAAAAACACCAAAAGCACTGTAA

GATAACCATCTTGACAGTGTGTATTGATTTGAAGTCCTGATAGAAAATATTTAGACAGTGGAGATTATCAAAAGATAACTAACCTTTCAGTTATGATAAA

TAGATGTGATTGGTTGCCATTTGTGTTCTTTTGCAGAACTCTGATAAGAAAAATGTTCAATTTGTATTTAAGCAAACAGTGAACGACATTTGCAATCAAC

TAAAAATTCGTCTATCGAATTAGGTCTGAGAATCACTGTTAAAGAGTATTGCCGTGTGTCTGGTGGCTCCCTTTTCAGGACTAGGGTCTCTCTCTCTCTC

TCATGGGGACAGCGTGTTAATATTTACCTACATAACTCTTTTGTTAATGGTTTTTGAAAAAAACCTCAGTTTCAAATTATTTGAGTAATCTCCATATTTT

CATTTAACCTCTGACTCTTTAATTTTTTTCCTGAGGAAAGTGTTTTTTTTTTTAATTTTTTTTAATGTTAAAAAATTGTATTTTTTTTAAAAATATCTTC

AAACTGAATCTTTTAAGCACCAAAGTTGGTTTTGAAAAGGAAAATAAAATCACTTTCTTGCTTGGCAGGCAAGAAGCCATATGGAATTTTTTTAACTTTT

ACAGAAATGTGTAACTTGTCAGTACTGTATCAAACAAATGTTGCATAGAGATAATAGAGCGTTGCTTGTAAATAATTCAGCAGATTTGTAATATATTTTT

CTATTATGAAATGTACTGTAGATGTTTTCTAGAGGCATGAAAGTCAATGTATATATTATGGTAGAAATAATATTGAAGGAAATTGTAATTCACTAGTGCT

GCCAGAGGGATTGCTAACAAAGCACCTTTAGGAGAGATGTCTGCAGACTGAAGGGACTGTGTACTACTGTTAATGTCTAAGAACAAAGCATTGGGCGGGC

GTCCTTCCAGAAAGTCTCTGAGGGAGGACGGAGACCCATAATAGAAGTTTATGGCACTCCCTCTGACAGTGGCTGAGTCGCTGTTCCTTACTGTTGGGAG

CGGTACCGTAAAGTAAGCGCCTGCTATGCAGTCAGGCTGCAGAAAGCACTCCTTCCTTGGAGTCCTCACTCCCTACAGTGACAGCAATACCAGCAGTTTT

TACTCTAAATTTTTTAAAGAATAGACAAATATAAATTTAATTCTTTGGTTCCAAAATGGGAAAGATTCCATGATACATAGATCATTTCTCATTTGCTTAA

AAAAGAAAGACCACACGCACAAGGTCCTAAAAGGATGGGGGGGCTTTAGCAGGTGAAGAGGTAGGCATGGAACAGTCATGGAGCCTGAGGGACGAGGGGG

AAGCACTGCGGATGGGCACGCTCGCTCGGGAACGGTCGGCTAAGACGCTCTGTAGCTAACAGGAGTCTATTTTCAGAAGAAGAAAGCAGTGTGTTTTTAC

TATGTTTTTCCTTTTGCTTAAGCACTTCATCACTTGTTTTATTCTGTATCTGCGAAGTACTCTCCGATCTCCTATGTTCCTTTAACATTTTGGTTTGTTA

AAATATTGCCAAATAGAGTGTTTGAGACATATAGTTTGTACTAGTATTTTTATTTTACTTCTCATGTTCTTGTAAGTCATTAATTGACCGATGATTGTAG

ACCTTGCTTGAGTATTTTTTCTAATAAAACAAAGCAAATTATACTTAGCTTCAAATTGTAACAATTCAATTTAATTTTAGGATGACATCTGGAAATACAC

ATTCAACATTTTCTTTAGGTGCATAGAGAACATTCATTACTGTCAATGTAGAAAATTTGTGATGTCAAACCATGCTGCTGGTTGTTGATTAGCCTCTGCG

TGCCCAGGTATCCAGGGTCCCTTTGCTTGTCATTGACTTGGGCTTGACACTTGTAAGTGAGCTAGTTTGGTAACTTGTGCGTGTGCATATCTACATATAC

ATTCAAATGTGATTGGAAAGTTAAGTCTGTAACATCCATTAATGTTTCTTCTTACCCAGCTCCGATCTTGCTCTGCCTGTCTGTATATGACATTTATGGT

GGACCTGGGTTGTTTCTGCCCCAAATCCATGTCTGGACAGTACAGACCATAGGCCCTGCTCTCATTTTCAGAGCTGTTGCTTGTCTTTTCCTGCCTATTG

GAGTACTGAGACTTGAGGGGCCCGAGAGCCTGAGGTGTTACGTCTGCTCTATACAGAGGTGCTTACTCATATCATGTAGCTGGTAACATTTTTGGAGCAG

TGAACACAGACCACACAGTTTGTACTCAATATGGCCATGTTGATAGTAGTAGTGAGCACGGGGCTAGAGCTCCGAGAAGACGGTTTAATACACTTCACAG

GAAGTGCTGCCACAGGCACCGAAGCACATGGCGTTTGGGTGGAACTTTTCATTTAAATTTCTTAATATTGTTGAGGATCTACAATTTTCCCATGTGTGCT

TTGTCTTTCAGGGATTGAATGAGAGTCTGTAAGTCAGACTCTGTTACAACCACAAGGAACGTTTGTTCTAGCGAAAAGAATCTTGAAGTAGGAAATGTTG

TAAAAATTTTAAATTCTTTATTTTTCTAGTAAACCTGTTCATACATTAATGTGGTTGCACATTAATTCTGAATTTCAGATGAAAAGAAAATAAAGTGGAC

AATACTTAACCCTCAAGTATTTTCACATGTGTCTATCTCATTGAACATAAAAAGCCGGGTGTGCTGACTAAAGCCCTGCATTTGGGAGGACGAAGCAAGA

GGATTTCCAAGAGTTCAAGGCCCGAGTGATATCCTGAGGCAAACAAACCAAAAAGGAAAGAAGAAATACTGATAATTAGAGTTTTTTTTCTCTGTGTCAC

ACATTAGGGAAATAGGTGCCATTGAGGTGGCTCTCGATGAAGGTGTTGGGCAACAGGCATGGTGGCCTGAGTTCCATGCCTGGGAGTCACGTGGTCTGAA

GCGAGAACAGACCGGAGAATTGTCTTCCCCAACAAGTAAATGTGCAAATGATCTTCTGCAAAGGTAGAATTTGCCAGAGTTAAAAACATGGATGATCTGT

TGTTTGCGTTGAACTGTTTTCTTGATGCATGGTTAACAAGAGATGAGATAATATTGACTGAATATCAAAGTGGGTAAATGTGGTTGAAGCAGTGTAAATA

GTTTGAGTAACAGCTTTACTTTTTTAATTTTTATAATACTCCTGTATAAATCCTAAAGGCAAACCAAATTTTAGACGGTGTGGACTTCGAGTAGAAAGCC

TGACACAGTGATGTGTCTGACAAGACCTCAGGTTGCAGAGATACATAAACATATGTGGTTTATTTGTAAAGAAAATTTCAAACCATATGTTATTTGGAAG

TCTTTTTTAAAAAGCAGAGTGGCACTTTGTGAGGTTTTAATTTAAGATATTTTTCTATTCTATTTCATAAAAGGTTAAAAAGTTTGTGTATAAATATTTT

TTTTAATTGTTCAAGAATCTTATGACCTGGTGTAGGGCATTTTGCAATTCTAACACTATAGCTTTAATATAAATAACATTTGTAGAGGTTTTCTTTGTAA

TAAAGGCGAGAATATTTTGTAATTTCTATTATTTCCTTTAGAACCTGAATAACCTTAAATATAGGCATGAAATGTTGTATTATGACTTTTATATTGTTAA

AATTTAAAAACAAAACTTATCCAACTTTATTTCTTTCCCAAGTTAAGTTTGTAGTGTCACACGGGACTGTTAATCTGCAAAGAGGGTGTAAGCAGGCTAG

AGCAGGTTTTTTCTAGGTCAGTTGCGTCTCAGAGATGAGCAAGGTGATGATAGATGTGTTTAACCTCACTATGATGTCCTCACTGATGCCCCCGAAGGCC

GCCAGGATTGTACTCCACACAAAATCACTGACAAAGTGTTTGTCCTGTCAGTACGGTGCTGTGGGCAACTGCAGCGCAGGGGACACTGGGGGTTGAGCTT

AGCAAGGGATGGTATCTGCCTTTACTGACAGACAGAATAAAGGGACCTACGCGTGGGTACCCAAACCTCTCCAGTGCGAAGGATTGTTGATGTTATTTTT

TATAATCTCAGTTGAAATGTAATTATTTGGATTTATTTAATCCTATTAAATATAGCTTGTTTTTGGAAGAACCCTCTAAGAACAGTAAGACCAATAAAAT

TGCTGTAAATGGCGTTTTCAGTAATTCTGTCCTCAGGACCTGTCTGGCCTGTGGTTTCTCTAGAAGGCTGCAGAGCCTTGCTGTTCTCTGTTGTGTGTTC

CTCAAGGTTGACATTCTCTGCCTGAAGAAAATGTGTCTTTACAAATTTTACAATTTTATAATGATTTCTATGTTTCTTGTAAAGGAATTGTTCACAAATT

TA
Translation
 - UNI10858 - - UNI18591 - MDIDSTISSGRSTPAMMNGQGSTTASSKHIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGG - UNI185

91 - VFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFK - UNI7736 - CVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPKAKEESPSKA

GMNKRRKLKNKRRRSLP - UNI5673 - PRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHST VIAKRKEESGKIKLLLHWMPEDI ILP

DVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYR RTMPQKRLKR
Transcript ENSMUST00000068583
Sequence
ATGTCGTCCGACGGGGAGCCGCTGAGCCGCATGGACTCGGAGGACAG - UNI10858 - - UNI18591 - CATAAGCAGTACGCTAATGGACATAG

ACAGCACAATTTCCAGTGGACGCTCAACCCCGGCCATGATGAATGGACAGGGGAGCACGACTGCTTCAAGCAAACACATTGCCTATAACTGTTGCTGGGA

CCAGTGCCAGGCATGCTTCAACTCCAGCCCAGACCTGGCAGACCACATTCGCTCCATACATGTCGATGGTCAGCGTGGAGGG - UNI18591 - GTGT

TCGTTTGCTTGTGGAAAGGTTGCAAGGTGTATAACACCCCGTCAACCAGTCAGAGTTGGCTACAGCGGCACATGCTGACACACAGTGGAGACAAGCCTTT

CAAG - UNI7736 - TGTGTAGTTGGTGGCTGCAATGCCAGCTTTGCTTCTCAGGGAGGGCTAGCTCGCCATGTACCCACACACTTCAGTCAGCAGAA

CTCCTCAAAAGTTTCTAGCCAGCCAAAGGCCAAAGAAGAATCTCCTTCTAAAGCTGGAATGAACAAGCGGAGGAAACTAAAGAACAAAAGACGGCGCTCA

TTAC - UNI5673 - CGCGGCCACACGATTTCTTCGATGCACAAACACTGGATGCCATAAGACATCGAGCCATCTGCTTTAACCTCTCTGCTCACATA

GAAAGTCTAGGGAAGGGACACAGTGTTGTTTTCCACAGTACT GTAATAGCGAAGAGAAAGGAGGAATCTGGAAAGATAAAGCTTTTGCTTCATTGGATG

CCGGAAGACAT TCTGCCAGATGTATGGGTGAATGAGAGTGAACGACATCAGTTAAAAACGAAAGTAGTTCATTTATCA - UNI11591 - AGCTACC

CAAAGATACTGCCTTGCTGTTGGACCCAAACATTTACAG AACAATGCCGCAGAAGAGGTTGA
Translation
MSSDGEPLSRMDSEDS - UNI10858 - - UNI18591 - SISSTLMDIDSTISSGRSTPAMMNGQGSTTASSKHIAYNCCWDQCQACFNSSPDLAD

HIRSIHVDGQRGG - UNI18591 - VFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFK - UNI7736 - CVVGGCNASFASQGGLARHVPTHF

SQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLP - UNI5673 - PRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHST VIAKR

KEESGKIKLLLHWMPEDI ILPDVWVNESERHQLKTKVVHLS - UNI11591 - SYPKILPCCWTQTFTE EQCRRRG
Transcript ENSMUST00000095350
Sequence
GCCGCCATGGCCGCCGCGCTCGCCGACATGGCCGACCTGGAGGAGCTCTCCCGCCTCAGCCCGCTGTCCCCCGGCAGCCCCGGGCCCGCGGCGCGCGGCC

GGGCCGAGCCGCCGGAGGAAGAGGAGGAGGAGGATGACGAGGAGGCGGAGGCAGAGGCGGTGGCCGCGCTGCTGTTGAACGGGGGAGCGGGCGGCGGCGC

GGGGGGCGGCGAGGCGGAGACCATGTCGGAGCCGAGCCCCGAGAGCGCCAGCCAGGCGGGCGGGGACGAGGACGAGGACGAGGAGGACGACGAGGACGAG

GGCAGCAGCAGCGGCGGCGCGGAGGAGGAGAGCAGCGCCGAGAGCCTGGTGGGCAGCAGCAGCGGCGGCTGCAGCGGCGACGAGACGCGCTCGCTGAGCC

CGGGCGCGGCGAGCAGCAGCAGCGGCGATGGGGACGGGAAGGAGGGCCTGGAGGAGCCCAAGGGACCGCGGGGCGGCCCGGGCGGCCCGGGCAGCAGCGG

TGGCGGTAGCAGCAGCAGTAGCGTGGTGTCGAGCGGCGGCGACGAGGGCTACGGCACCGGGGGAGGCGGGAGCAGCGCGACCTCCGGGGGCCGGCGGGGC

AGCCTGGAGATGTCGTCCGACGGGGAGCCGCTGAGCCGCATGGACTCGGAGGACAG - UNI10858 - - UNI18591 - CATAAGCAGTACGCTAA

TGGACATAGACAGCACAATTTCCAGTGGACGCTCAACCCCGGCCATGATGAATGGACAGGGGAGCACGACTGCTTCAAGCAAACACATTGCCTATAACTG

TTGCTGGGACCAGTGCCAGGCATGCTTCAACTCCAGCCCAGACCTGGCAGACCACATTCGCTCCATACATGTCGATGGTCAGCGTGGAGGG - UNI185

91 - GTGTTCGTTTGCTTGTGGAAAGGTTGCAAGGTGTATAACACCCCGTCAACCAGTCAGAGTTGGCTACAGCGGCACATGCTGACACACAGTGGAGA

CAAGCCTTTCAAG - UNI7736 - TGTGTAGTTGGTGGCTGCAATGCCAGCTTTGCTTCTCAGGGAGGGCTAGCTCGCCATGTACCCACACACTTCAG

TCAGCAGAACTCCTCAAAAGTTTCTAGCCAGCCAAAGGCCAAAGAAGAATCTCCTTCTAAAGCTGGAATGAACAAGCGGAGGAAACTAAAGAACAAAAGA

CGGCGCTCATTAC - UNI5673 - CGCGGCCACACGATTTCTTCGATGCACAAACACTGGATGCCATAAGACATCGAGCCATCTGCTTTAACCTCTCT

GCTCACATAGAAAGTCTAGGGAAGGGACACAGTGTTGTTTTCCACAGTACT GTAATAGCGAAGAGAAAGGAGGAATCTGGAAAGATAAAGCTTTTGCTT

CATTGGATGCCGGAAGACAT TCTGCCAGATGTATGGGTGAATGAGAGTGAACGACATCAGTTAAAAACGAAAGTAGTTCATTTATCAAAGCTACCCAAA

GATACTGCCTTGCTGTTGGACCCAAACATTTACAG AACAATGCCGCAGAAGAGGTTGAAGAG - UNI27916 - ATTTGACATCCTCAATTTCCCAA

GGTGA
Translation
MSSDGEPLSRMDSEDS - UNI10858 - - UNI18591 - SISSTLMDIDSTISSGRSTPAMMNGQGSTTASSKHIAYNCCWDQCQACFNSSPDLAD

HIRSIHVDGQRGG - UNI18591 - VFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFK - UNI7736 - CVVGGCNASFASQGGLARHVPTHF

SQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLP - UNI5673 - PRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHST VIAKR

KEESGKIKLLLHWMPEDI ILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYR RTMPQKRLKR - UNI27916 - RFDILNFPR
Transcript ENSMUST00000087614
Sequence
GCCGCCATGGCCGCCGCGCTCGCCGACATGGCCGACCTGGAGGAGCTCTCCCGCCTCAGCCCGCTGTCCCCCGGCAGCCCCGGGCCCGCGGCGCGCGGCC

GGGCCGAGCCGCCGGAGGAAGAGGAGGAGGAGGATGACGAGGAGGCGGAGGCAGAGGCGGTGGCCGCGCTGCTGTTGAACGGGGGAGCGGGCGGCGGCGC

GGGGGGCGGCGAGGCGGAGACCATGTCGGAGCCGAGCCCCGAGAGCGCCAGCCAGGCGGGCGGGGACGAGGACGAGGACGAGGAGGACGACGAGGACGAG

GGCAGCAGCAGCGGCGGCGCGGAGGAGGAGAGCAGCGCCGAGAGCCTGGTGGGCAGCAGCAGCGGCGGCTGCAGCGGCGACGAGACGCGCTCGCTGAGCC

CGGGCGCGGCGAGCAGCAGCAGCGGCGATGGGGACGGGAAGGAGGGCCTGGAGGAGCCCAAGGGACCGCGGGGCGGCCCGGGCGGCCCGGGCAGCAGCGG

TGGCGGTAGCAGCAGCAGTAGCGTGGTGTCGAGCGGCGGCGACGAGGGCTACGGCACCGGGGGAGGCGGGAGCAGCGCGACCTCCGGGGGCCGGCGGGGC

AGCCTGGAGATGTCGTCCGACGGGGAGCCGCTGAGCCGCATGGACTCGGAGGACAG - UNI10858 - - UNI18591 - CATAAGCAGTACGCTAA

TGGACATAGACAGCACAATTTCCAGTGGACGCTCAACCCCGGCCATGATGAATGGACAGGGGAGCACGACTGCTTCAAGCAAACACATTGCCTATAACTG

TTGCTGGGACCAGTGCCAGGCATGCTTCAACTCCAGCCCAGACCTGGCAGACCACATTCGCTCCATACATGTCGATGGTCAGCGTGGAGGG - UNI185

91 - GTGTTCGTTTGCTTGTGGAAAGGTTGCAAGGTGTATAACACCCCGTCAACCAGTCAGAGTTGGCTACAGCGGCACATGCTGACACACAGTGGAGA

CAAGCCTTTCAAG - UNI7736 - TGTGTAGTTGGTGGCTGCAATGCCAGCTTTGCTTCTCAGGGAGGGCTAGCTCGCCATGTACCCACACACTTCAG

TCAGCAGAACTCCTCAAAAGTTTCTAGCCAGCCAAAGGCCAAAGAAGAATCTCCTTCTAAAGCTGGAATGAACAAGCGGAGGAAACTAAAGAACAAAAGA

CGGCGCTCATTAC - UNI5673 - CGCGGCCACACGATTTCTTCGATGCACAAACACTGGATGCCATAAGACATCGAGCCATCTGCTTTAACCTCTCT

GCTCACATAGAAAGTCTAGGGAAGGGACACAGTGTTGTTTTCCACAGTACT GTAATAGCGAAGAGAAAGGAGGAATCTGGAAAGATAAAGCTTTTGCTT

CATTGGATGCCGGAAGACAT TCTGCCAGATGTATGGGTGAATGAGAGTGAACGACATCAGTTAAAAACGAAAGTAGTTCATTTATCAAAGCTACCCAAA

GATACTGCCTTGCTGTTGGACCCAAACATTTACAG AACAATGCCGCAGAAGAGGTTGAAGAGGTAAAACATTCATAAATACATAAAAGCAAACACGCGG

GGACACCTGCAGTCTTAGTCACTGACAATGGGCTTAGGGAAAGTTGCACATTACAGTCAACCCCTTCCTTCCTCCTTTACTTTAAGTCCAGTATTTAGAG

TACTATTTATGGCTAGTGTGGACATTCTGTGAGTGAAGGAGGTCTTCTGTGGAATATATTAATATATACTGCAGTCCACATGGCATGGAATGGCGCTGTG

GGAGACTGCGCAGACACTCTCTGGCAACTCAGTGGAACAGCTTCTGAAAAGGCTTTGCATGCTCGCTGCTTAAGCTGCTTTTTTTCTTCCCCCCTAGTGA

TTACAGTAGTTTTATTGGAGAGACAAACAATTGCCCTTAAAAACACCAAAAGCACTGTAAGATAACCATCTTGACAGTGTGTATTGATTTGAAGTCCTGA

TAGAAAATATTTAGACAGTGGAGATTATCAAAAGATAACTAACCTTTCAGTTATGATAAATAGATGTGATTGGTTGCCATTTGTGTTCTTTTGCAGAACT

CTGATAAGAAAAATGTTCAATTTGTATTTAAGCAAACAGTGAACGACATTTGCAATCAACTAAAAATTCGTCTATCGAATTAGGTCTGAGAATCACTGTT

AAAGAGTATTGCCGTGTGTCTGGTGGCTCCCTTTTCAGGACTAGGGTCTCTCTCTCTCTCTCATGGGGACAGCGTGTTAATATTTACCTACATAACTCTT

TTGTTAATGGTTTTTGAAAAAAACCTCAGTTTCAAATTATTTGAGTAATCTCCATATTTTCATTTAACCTCTGACTCTTTAATTTTTTTCCTGAGGAAAG

TGTTTTTTTTTTTAATTTTTTTTAATGTTAAAAAATTGTATTTTTTTTAAAAATATCTTCAAACTGAATCTTTTAAGCACCAAAGTTGGTTTTGAAAAGG

AAAATAAAATCACTTTCTTGCTTGGCAGGCAAGAAGCCATATGGAATTTTTTTAACTTTTACAGAAATGTGTAACTTGTCAGTACTGTATCAAACAAATG

TTGCATAGAGATAATAGAGCGTTGCTTGTAAATAATTCAGCAGATTTGTAATATATTTTTCTATTATGAAATGTACTGTAGATGTTTTCTAGAGGCATGA

AAGTCAATGTATATATTATGGTAGAAATAATATTGAAGGAAATTGTAATTCACTAGTGCTGCCAGAGGGATTGCTAACAAAGCACCTTTAGGAGAGATGT

CTGCAGACTGAAGGGACTGTGTACTACTGTTAATGTCTAAGAACAAAGCATTGGGCGGGCGTCCTTCCAGAAAGTCTCTGAGGGAGGACGGAGACCCATA

ATAGAAGTTTATGGCACTCCCTCTGACAGTGGCTGAGTCGCTGTTCCTTACTGTTGGGAGCGGTACCGTAAAGTAAGCGCCTGCTATGCAGTCAGGCTGC

AGAAAGCACTCCTTCCTTGGAGTCCTCACTCCCTACAGTGACAGCAATACCAGCAGTTTTTACTCTAAATTTTTTAAAGAATAGACAAATATAAATTTAA

TTCTTTGGTTCCAAAATGGGAAAGATTCCATGATACATAGATCATTTCTCATTTGCTTAAAAAAGAAAGACCACACGCACAAGGTCCTAAAAGGATGGGG

GGGCTTTAGCAGGTGAAGAGGTAGGCATGGAACAGTCATGGAGCCTGAGGGACGAGGGGGAAGCACTGCGGATGGGCACGCTCGCTCGGGAACGGTCGGC

TAAGACGCTCTGTAGCTAACAGGAGTCTATTTTCAGAAGAAGAAAGCAGTGTGTTTTTACTATGTTTTTCCTTTTGCTTAAGCACTTCATCACTTGTTTT

ATTCTGTATCTGCGAAGTACTCTCCGATCTCCTATGTTCCTTTAACATTTTGGTTTGTTAAAATATTGCCAAATAGAGTGTTTGAGACATATAGTTTGTA

CTAGTATTTTTATTTTACTTCTCATGTTCTTGTAAGTCATTAATTGACCGATGATTGTAGACCTTGCTTGAGTATTTTTTCTAATAAAACAAAGCAAATT

ATACTTAGCTTCAAATTGTAACAATTCAATTTAATTTTAGGATGACATCTGGAAATACACATTCAACATTTTCTTTAGGTGCATAGAGAACATTCATTAC

TGTCAATGTAGAAAATTTGTGATGTCAAACCATGCTGCTGGTTGTTGATTAGCCTCTGCGTGCCCAGGTATCCAGGGTCCCTTTGCTTGTCATTGACTTG

GGCTTGACACTTGTAAGTGAGCTAGTTTGGTAACTTGTGCGTGTGCATATCTACATATACATTCAAATGTGATTGGAAAGTTAAGTCTGTAACATCCATT

AATGTTTCTTCTTACCCAGCTCCGATCTTGCTCTGCCTGTCTGTATATGACATTTATGGTGGACCTGGGTTGTTTCTGCCCCAAATCCATGTCTGGACAG

TACAGACCATAGGCCCTGCTCTCATTTTCAGAGCTGTTGCTTGTCTTTTCCTGCCTATTGGAGTACTGAGACTTGAGGGGCCCGAGAGCCTGAGGTGTTA

CGTCTGCTCTATACAGAGGTGCTTACTCATATCATGTAGCTGGTAACATTTTTGGAGCAGTGAACACAGACCACACAGTTTGTACTCAATATGGCCATGT

TGATAGTAGTAGTGAGCACGGGGCTAGAGCTCCGAGAAGACGGTTTAATACACTTCACAGGAAGTGCTGCCACAGGCACCGAAGCACATGGCGTTTGGGT

GGAACTTTTCATTTAAATTTCTTAATATTGTTGAGGATCTACAATTTTCCCATGTGTGCTTTGTCTTTCAGGGATTGAATGAGAGTCTGTAAGTCAGACT

CTGTTACAACCACAAGGAACGTTTGTTCTAGCGAAAAGAATCTTGAAGTAGGAAATGTTGTAAAAATTTTAAATTCTTTATTTTTCTAGTAAACCTGTTC

ATACATTAATGTGGTTGCACATTAATTCTGAATTTCAGATGAAAAGAAAATAAAGTGGACAATACTTAACCCTCAAGTATTTTCACATGTGTCTATCTCA

TTGAACATAAAAAGCCGGGTGTGCTGACTAAAGCCCTGCATTTGGGAGGACGAAGCAAGAGGATTTCCAAGAGTTCAAGGCCCGAGTGATATCCTGAGGC

AAACAAACCAAAAAGGAAAGAAGAAATACTGATAATTAGAGTTTTTTTTCTCTGTGTCACACATTAGGGAAATAGGTGCCATTGAGGTGGCTCTCGATGA

AGGTGTTGGGCAACAGGCATGGTGGCCTGAGTTCCATGCCTGGGAGTCACGTGGTCTGAAGCGAGAACAGACCGGAGAATTGTCTTCCCCAACAAGTAAA

TGTGCAAATGATCTTCTGCAAAGGTAGAATTTGCCAGAGTTAAAAACATGGATGATCTGTTGTTTGCGTTGAACTGTTTTCTTGATGCATGGTTAACAAG

AGATGAGATAATATTGACTGAATATCAAAGTGGGTAAATGTGGTTGAAGCAGTGTAAATAGTTTGAGTAACAGCTTTACTTTTTTAATTTTTATAATACT

CCTGTATAAATCCTAAAGGCAAACCAAATTTTAGACGGTGTGGACTTCGAGTAGAAAGCCTGACACAGTGATGTGTCTGACAAGACCTCAGGTTGCAGAG

ATACATAAACATATGTGGTTTATTTGTAAAGAAAATTTCAAACCATATGTTATTTGGAAGTCTTTTTTAAAAAGCAGAGTGGCACTTTGTGAGGTTTTAA

TTTAAGATATTTTTCTATTCTATTTCATAAAAGGTTAAAAAGTTTGTGTATAAATATTTTTTTTAATTGTTCAAGAATCTTATGACCTGGTGTAGGGCAT

TTTGCAATTCTAACACTATAGCTTTAATATAAATAACATTTGTAGAGGTTTTCTTTGTAATAAAGGCGAGAATATTTTGTAATTTCTATTATTTCCTTTA

GAACCTGAATAACCTTAAATATAGGCATGAAATGTTGTATTATGACTTTTATATTGTTAAAATTTAAAAACAAAACTTATCCAACTTTATTTCTTTCCCA

AGTTAAGTTTGTAGTGTCACACGGGACTGTTAATCTGCAAAGAGGGTGTAAGCAGGCTAGAGCAGGTTTTTTCTAGGTCAGTTGCGTCTCAGAGATGAGC

AAGGTGATGATAGATGTGTTTAACCTCACTATGATGTCCTCACTGATGCCCCCGAAGGCCGCCAGGATTGTACTCCACACAAAATCACTGACAAAGTGTT

TGTCCTGTCAGTACGGTGCTGTGGGCAACTGCAGCGCAGGGGACACTGGGGGTTGAGCTTAGCAAGGGATGGTATCTGCCTTTACTGACAGACAGAATAA

AGGGACCTACGCGTGGGTACCCAAACCTCTCCAGTGCGAAGGATTGTTGATGTTATTTTTTATAATCTCAGTTGAAATGTAATTATTTGGATTTATTTAA

TCCTATTAAATATAGCTTGTTTTTGGAAGAACCCTCTAAGAACAGTAAGACCAATAAAATTGCTGTAAATGGCGTTTTCAGTAATTCTGTCCTCAGGACC

TGTCTGGCCTGTGGTTTCTCTAGAAGGCTGCAGAGCCTTGCTGTTCTCTGTTGTGTGTTCCTCAAGGTTGACATTCTCTGCCTGAAGAAAATGTGTCTTT

ACAAATTTTACAATTTTATAATGATTTCTATGTTTCTTGTAAAGGAATTGTTCACAAATTTA
Translation
MAAALADMADLEELSRLSPLSPGSPGPAARGRAEPPEEEEEEDDEEAEAEAVAALLLNGGAGGGAGGGEAETMSEPSPESASQAGGDEDEDEEDDEDEGS

SSGGAEEESSAESLVGSSSGGCSGDETRSLSPGAASSSSGDGDGKEGLEEPKGPRGGPGGPGSSGGGSSSSSVVSSGGDEGYGTGGGGSSATSGGRRGSL

EMSSDGEPLSRMDSEDS - UNI10858 - - UNI18591 - SISSTLMDIDSTISSGRSTPAMMNGQGSTTASSKHIAYNCCWDQCQACFNSSPDLA

DHIRSIHVDGQRGG - UNI18591 - VFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFK - UNI7736 - CVVGGCNASFASQGGLARHVPTH

FSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLP - UNI5673 - PRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHST VIAK

RKEESGKIKLLLHWMPEDI ILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYR RTMPQKRLKR

For any suggestions or comments, please send an email to unitrap@crg.es