Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030243 (Recql)
Chromosomal location
Chr 6: 142298862 - 142335607 (-)
Description
RecQ protein-like Gene [Source:MGI Symbol;Acc:MGI:103021]
RefSeq_dna
NM_023042 
RefSeq_peptide
NP_075529.2 
MGI
MGI:103021 
Uniprot/SWISSPROT
Q9Z129 
Uniprot/SPTREMBL
Q8BQQ9 Q3UFL0 Q3UUK0 Q3TPI5 Q91YU1 
Human Ortholog
ENSG00000004700 (RECQL)
Omim not available
UniTrap UNI17432
Vector Insertion
Chr 6: 142333097 - 142335541
Public Clones not available
Private Clones OST443080 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26967
Vector Insertion
Chr 6: 142326871 - 142333048
Public Clones not available
Private Clones OST81364 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12567
Vector Insertion
Chr 6: 142313176 - 142314035
Public Clones F060D03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111804
Sequence
GATCCGGAAGGGTGGGCGCTGCATGCCGGGCGGCGGGAAGGTTTTTACGCGCGGAGCGGCTGACAG - UNI17432 - AAGGACATTTGGATCTCCGG

TTCAGTTTTAGAATGGCATCCGTCTCAG - UNI26967 - CTTTGACAGAGGAACTGGAATCCGTAGCCAGTGAGCTTCATGCCATTGACATCCAGAT

TCAGGAACTCACAGAGAGGCGGCAAGAGCTCCTTCAGAGAAAGTCAGTCCTGACAGGGAAAATCAAACAGTACTTGGAGGACTCTTCGGCTGAGGCGAGC

AGCGACTTGGACACATCACCAGCTGCTTGGAATAAAGAAG ATTTTCCATGGTTCGGAAAGGTAAAAGATGTGCTGCAAAATGTTTTTAAACTGCAAAAA

TTCAGACCTCTGCAGCTGGAAACCATCAATGTCACCATGGCTAGAAAGGATATCTTTCTTGTCATGCCCACAGGAGGAGGGAAGAGCTTATGCTACCAGC

TACCTGCGCTGTGCTCAGACG GTTTTACACTTGTGATTTGCCCACTCATCTCTCTTATGGAAGATCAGCTGATGGTTTTAAAACAGTTGGGAATTTCAG

CTACTATGTTGAATGCTTCCAGCTCTAAG GAACATGTAAAATGGGTGCACGCTGAAATGGTGAATAAAAACTCCCAGTTAAAGCTGATTTATGTAACTC

CAGAGAAAATTGCAAAAAGCAAGATGTTCATGTCAAGACTGGAGAAAGCCTATGAAGCCGGGAGGCTGACGGGAGCGGCAGTGGATGAAGTGCATTGCTG

CAGTCAGTGGGGTCATGACTTCAGGCCTG ATTATAAGGCTCTTGGCATCTTGAAGCGCCAGTTTCCCAACGCCTCACTGATGGGGCTGACTGCAACAGC

AACCAACCATGTTCTGAAGGATGTACAGAAAATCCTGTGTGTGGGAAAGTGTTTGACTTTTACAGCGTCTTTCAACCGGCCAAATCTTTTTTATGAG GT

TCGGCAAAAGCCCTCAAGTGCTGAAGACTTTACTGAGGACATTGTCAAGCTAATTAATGGACGGTACAAAGGACAATCAG GAATCATATACTGTTTCTC

TCAGAAAGACTCTGAACAAATTACCATCAGTTTACAGAAGTTGGGAATTCATGCAGGCACTTACCATGCCAATATGGAACCAGAAGATAAGACCAAGGTT

CATACACAGTGGTCAGCCAATGAGCTTCAG GTGGTAGTGGCAACAGTCGCATTTGGCATGGGAATTGATAAGCCAGACGTGAGGTTTGTCATCCATCAT

TCAATGAGCAAATCCATGGAGAATTACTATCAAGAGAGCGGGCGTGCCG GTCGCGATGACTCGAGAGCAGACTGTATTCTGTATTACGGCTTTGGGGAC

ATATTCAGGATCAGCTCGATGGTGGTCATGGAGAACGTGGGGCAGCAGAAGCTGTATGAGATGGTGTCATACTGCCAGAATGTCAGCAA GTGTCGCCGT

GTGTTAATAGCACAGCATTTTGATGAAGTGTGGAACGCAGATGCCTGTAACAAAATGTGTGACAACTGCTGTAAAGACGTTT - UNI12567 - CGTT

TGAGAAAAAGAATGTGACACAGCACTGCCGGGACCTGATAAAGATTCTGAAGCAGGCTGAAGGCCTGAATGAAAAGCTGACCCCGCTGAAGCTGATTGAT

GCTTGGATGGGAAAGGGAGCAGCCAAGTTGAGAGTGGCTGGCGTTGTTGCCCCGGCCCTTCCCCGGGAAGACCTGGAGAGAATCGTCGCCCACGCCCTCC

TGCAGCAATATCTCAA AGAAGACTACAGCTTCACGGCTTACGCCACCATCTCCTATCTGAAGGTGGGACCCAGAGCTTGTCTTCTCAGCAACGAAGCCC

ATGCTGTCACTATGCAAGTGAAGAAGTCAGCACAGAGCAGCGTTAGG GGTGCACTGTCTGAAGCTCGTCAGGTGGAACAAGTGGATTCGAAGGGGGAAG

AGCAAAGCTCAG CTTCAGGTTCTTCACCTGAAATAAACACTACCTCTGCCCCGGGGCGATTGGGAGGACAGGCTGGCTTTAAACGATGA
Translation
 - UNI17432 -  - UNI26967 -         MVVMENVGQQKLYEMVSYCQNVSK KCRRVLIAQHFDEVWNADACNKMCDNCCKDVS - UNI1

2567 - SFEKKNVTQHCRDLIKILKQAEGLNEKLTPLKLIDAWMGKGAAKLRVAGVVAPALPREDLERIVAHALLQQYLK KEDYSFTAYATISYLKVG

PRACLLSNEAHAVTMQVKKSAQSSVR GALSEARQVEQVDSKGEEQSSA ASGSSPEINTTSAPGRLGGQAGFKR
Transcript ENSMUST00000100832
Sequence
GATCCGGAAGGGTGGGCGCTGCATGCCGGGCGGCGGGAAGGTTTTTACGCGCGGAGCGGCTGACAG - UNI17432 - AAGGACATTTGGATCTCCGG

TTCAGTTTTAGAATGGCATCCGTCTCAG - UNI26967 - CTTTGACAGAGGAACTGGAATCCGTAGCCAGTGAGCTTCATGCCATTGACATCCAGAT

TCAGGAACTCACAGAGAGGCGGCAAGAGCTCCTTCAGAGAAAGTCAGTCCTGACAGGGAAAATCAAACAGTACTTGGAGGACTCTTCGGCTGAGGCGAGC

AGCGACTTGGACACATCACCAGCTGCTTGGAATAAAGAAG ATTTTCCATGGTTCGGAAAGGTAAAAGATGTGCTGCAAAATGTTTTTAAACTGCAAAAA

TTCAGACCTCTGCAGCTGGAAACCATCAATGTCACCATGGCTAGAAAGGATATCTTTCTTGTCATGCCCACAGGAGGAGGGAAGAGCTTATGCTACCAGC

TACCTGCGCTGTGCTCAGACG GTTTTACACTTGTGATTTGCCCACTCATCTCTCTTATGGAAGATCAGCTGATGGTTTTAAAACAGTTGGGAATTTCAG

CTACTATGTTGAATGCTTCCAGCTCTAAG GAACATGTAAAATGGGTGCACGCTGAAATGGTGAATAAAAACTCCCAGTTAAAGCTGATTTATGTAACTC

CAGAGAAAATTGCAAAAAGCAAGATGTTCATGTCAAGACTGGAGAAAGCCTATGAAGCCGGGAGGCTGACGGGAGCGGCAGTGGATGAAGTGCATTGCTG

CAGTCAGTGGGGTCATGACTTCAGGCCTG ATTATAAGGCTCTTGGCATCTTGAAGCGCCAGTTTCCCAACGCCTCACTGATGGGGCTGACTGCAACAGC

AACCAACCATGTTCTGAAGGATGTACAGAAAATCCTGTGTGTGGGAAAGTGTTTGACTTTTACAGCGTCTTTCAACCGGCCAAATCTTTTTTATGAG GT

TCGGCAAAAGCCCTCAAGTGCTGAAGACTTTACTGAGGACATTGTCAAGCTAATTAATGGACGGTACAAAGGACAATCAG GAATCATATACTGTTTCTC

TCAGAAAGACTCTGAACAAATTACCATCAGTTTACAGAAGTTGGGAATTCATGCAGGCACTTACCATGCCAATATGGAACCAGAAGATAAGACCAAGGTT

CATACACAGTGGTCAGCCAATGAGCTTCAG GTGGTAGTGGCAACAGTCGCATTTGGCATGGGAATTGATAAGCCAGACGTGAGGTTTGTCATCCATCAT

TCAATGAGCAAATCCATGGAGAATTACTATCAAGAGAGCGGGCGTGCCG GTCGCGATGACTCGAGAGCAGACTGTATTCTGTATTACGGCTTTGGGGAC

ATATTCAGGATCAGCTCGATGGTGGTCATGGAGAACGTGGGGCAGCAGAAGCTGTATGAGATGGTGTCATACTGCCAGAATGTCAGCAA GTGTCGCCGT

GTGTTAATAGCACAGCATTTTGATGAAGTGTGGAACGCAGATGCCTGTAACAAAATGTGTGACAACTGCTGTAAAGACGTTT - UNI12567 - CGTT

TGAGAAAAAGAATGTGACACAGCACTGCCGGGACCTGATAAAGATTCTGAAGCAGGCTGAAGGCCTGAATGAAAAGCTGACCCCGCTGAAGCTGATTGAT

GCTTGGATGGGAAAGGGAGCAGCCAAGTTGAGAGTGGCTGGCGTTGTTGCCCCGGCCCTTCCCCGGGAAGACCTGGAGAGAATCGTCGCCCACGCCCTCC

TGCAGCAATATCTCAA AGAAGACTACAGCTTCACGGCTTACGCCACCATCTCCTATCTGAAGGTGGGACCCAGAGCTTGTCTTCTCAGCAACGAAGCCC

ATGCTGTCACTATGCAAGTGAAGAAGTCAGCACAGAGCAGCGTTAGG GGTGCACTGTCTGAAGCTCGTCAGGTGGAACAAGTGGATTCGAAGGGGGAAG

AGCAAAGCTCAG ACACACCAGACAAGAGCATCAGATCCCATTACAGATGGTTGTGA
Translation
 - UNI17432 - MASVSA - UNI26967 - ALTEELESVASELHAIDIQIQELTERRQELLQRKSVLTGKIKQYLEDSSAEASSDLDTSPAAWNKE

D DFPWFGKVKDVLQNVFKLQKFRPLQLETINVTMARKDIFLVMPTGGGKSLCYQLPALCSDG GFTLVICPLISLMEDQLMVLKQLGISATMLNASSSK

 EHVKWVHAEMVNKNSQLKLIYVTPEKIAKSKMFMSRLEKAYEAGRLTGAAVDEVHCCSQWGHDFRPD DYKALGILKRQFPNASLMGLTATATNHVLKD

VQKILCVGKCLTFTASFNRPNLFYE VRQKPSSAEDFTEDIVKLINGRYKGQSG GIIYCFSQKDSEQITISLQKLGIHAGTYHANMEPEDKTKVHTQWS

ANELQ VVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAG GRDDSRADCILYYGFGDIFRISSMVVMENVGQQKLYEMVSYCQNVSK KCRRV

LIAQHFDEVWNADACNKMCDNCCKDVS - UNI12567 - SFEKKNVTQHCRDLIKILKQAEGLNEKLTPLKLIDAWMGKGAAKLRVAGVVAPALPRED

LERIVAHALLQQYLK KEDYSFTAYATISYLKVGPRACLLSNEAHAVTMQVKKSAQSSVR GALSEARQVEQVDSKGEEQSSD DTPDKSIRSHYRWL
Transcript ENSMUST00000032370
Sequence
CGGAGCGGCTGACAG - UNI17432 - AAGGACATTTGGATCTCCGGTTCAGTTTTAGAATGGCATCCGTCTCAG - UNI26967 - CTTTGACAG

AGGAACTGGAATCCGTAGCCAGTGAGCTTCATGCCATTGACATCCAGATTCAGGAACTCACAGAGAGGCGGCAAGAGCTCCTTCAGAGAAAGTCAGTCCT

GACAGGGAAAATCAAACAGTACTTGGAGGACTCTTCGGCTGAGGCGAGCAGCGACTTGGACACATCACCAGCTGCTTGGAATAAAGAAG ATTTTCCATG

GTTCGGAAAGGTAAAAGATGTGCTGCAAAATGTTTTTAAACTGCAAAAATTCAGACCTCTGCAGCTGGAAACCATCAATGTCACCATGGCTAGAAAGGAT

ATCTTTCTTGTCATGCCCACAGGAGGAGGGAAGAGCTTATGCTACCAGCTACCTGCGCTGTGCTCAGACG GTTTTACACTTGTGATTTGCCCACTCATC

TCTCTTATGGAAGATCAGCTGATGGTTTTAAAACAGTTGGGAATTTCAGCTACTATGTTGAATGCTTCCAGCTCTAAG GAACATGTAAAATGGGTGCAC

GCTGAAATGGTGAATAAAAACTCCCAGTTAAAGCTGATTTATGTAACTCCAGAGAAAATTGCAAAAAGCAAGATGTTCATGTCAAGACTGGAGAAAGCCT

ATGAAGCCGGGAGGCTGACGGGAGCGGCAGTGGATGAAGTGCATTGCTGCAGTCAGTGGGGTCATGACTTCAGGCCTG ATTATAAGGCTCTTGGCATCT

TGAAGCGCCAGTTTCCCAACGCCTCACTGATGGGGCTGACTGCAACAGCAACCAACCATGTTCTGAAGGATGTACAGAAAATCCTGTGTGTGGGAAAGTG

TTTGACTTTTACAGCGTCTTTCAACCGGCCAAATCTTTTTTATGAG GTTCGGCAAAAGCCCTCAAGTGCTGAAGACTTTACTGAGGACATTGTCAAGCT

AATTAATGGACGGTACAAAGGACAATCAG GAATCATATACTGTTTCTCTCAGAAAGACTCTGAACAAATTACCATCAGTTTACAGAAGTTGGGAATTCA

TGCAGGCACTTACCATGCCAATATGGAACCAGAAGATAAGACCAAGGTTCATACACAGTGGTCAGCCAATGAGCTTCAG GTGGTAGTGGCAACAGTCGC

ATTTGGCATGGGAATTGATAAGCCAGACGTGAGGTTTGTCATCCATCATTCAATGAGCAAATCCATGGAGAATTACTATCAAGAGAGCGGGCGTGCCG G

TCGCGATGACTCGAGAGCAGACTGTATTCTGTATTACGGCTTTGGGGACATATTCAGGATCAGCTCGATGGTGGTCATGGAGAACGTGGGGCAGCAGAAG

CTGTATGAGATGGTGTCATACTGCCAGAATGTCAGCAA GTGTCGCCGTGTGTTAATAGCACAGCATTTTGATGAAGTGTGGAACGCAGATGCCTGTAAC

AAAATGTGTGACAACTGCTGTAAAGACGTTT - UNI12567 - CGTTTGAGAAAAAGAATGTGACACAGCACTGCCGGGACCTGATAAAGATTCTGAA

GCAGGCTGAAGGCCTGAATGAAAAGCTGACCCCGCTGAAGCTGATTGATGCTTGGATGGGAAAGGGAGCAGCCAAGTTGAGAGTGGCTGGCGTTGTTGCC

CCGGCCCTTCCCCGGGAAGACCTGGAGAGAATCGTCGCCCACGCCCTCCTGCAGCAATATCTCAA AGAAGACTACAGCTTCACGGCTTACGCCACCATC

TCCTATCTGAAGGTGGGACCCAGAGCTTGTCTTCTCAGCAACGAAGCCCATGCTGTCACTATGCAAGTGAAGAAGTCAGCACAGAGCAGCGTTAGG GGT

GCACTGTCTGAAGCTCGTCAGGTGGAACAAGTGGATTCGAAGGGGGAAGAGCAAAGCTCAG GCTCTCATGCAGCCGACACAGCCGCCAATGTCTAGTGT

GTCTGGGGATGGCCTCGAGGTCCTGATCTTCCTGTCTCCCCTCCAAAGTGCCCTCAGCACAGGAGTACACCAGGCCTGATCATGGAATGCTGTGTTTTAA

TTCAAGTGGAAAACATGCTGACCTCAAAAACTAGTGCACCATGGCTTTAAAGCTATGTCAACATTA
Translation
 - UNI17432 - MASVSA - UNI26967 - ALTEELESVASELHAIDIQIQELTERRQELLQRKSVLTGKIKQYLEDSSAEASSDLDTSPAAWNKE

D DFPWFGKVKDVLQNVFKLQKFRPLQLETINVTMARKDIFLVMPTGGGKSLCYQLPALCSDG GFTLVICPLISLMEDQLMVLKQLGISATMLNASSSK

 EHVKWVHAEMVNKNSQLKLIYVTPEKIAKSKMFMSRLEKAYEAGRLTGAAVDEVHCCSQWGHDFRPD DYKALGILKRQFPNASLMGLTATATNHVLKD

VQKILCVGKCLTFTASFNRPNLFYE VRQKPSSAEDFTEDIVKLINGRYKGQSG GIIYCFSQKDSEQITISLQKLGIHAGTYHANMEPEDKTKVHTQWS

ANELQ VVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAG GRDDSRADCILYYGFGDIFRISSMVVMENVGQQKLYEMVSYCQNVSK KCRRV

LIAQHFDEVWNADACNKMCDNCCKDVS - UNI12567 - SFEKKNVTQHCRDLIKILKQAEGLNEKLTPLKLIDAWMGKGAAKLRVAGVVAPALPRED

LERIVAHALLQQYLK KEDYSFTAYATISYLKVGPRACLLSNEAHAVTMQVKKSAQSSVR GALSEARQVEQVDSKGEEQSSG GSHAADTAANV
Transcript ENSMUST00000111803
Sequence
GATCCGGAAGGGTGGGCGCTGCATGCCGGGCGGCGGGAAGGTTTTTACGCGCGGAGCGGCTGACAG - UNI17432 - AAGGACATTTGGATCTCCGG

TTCAGTTTTAGAATGGCATCCGTCTCAG - UNI26967 - CTTTGACAGAGGAACTGGAATCCGTAGCCAGTGAGCTTCATGCCATTGACATCCAGAT

TCAGGAACTCACAGAGAGGCGGCAAGAGCTCCTTCAGAGAAAGTCAGTCCTGACAGGGAAAATCAAACAGTACTTGGAGGACTCTTCGGCTGAGGCGAGC

AGCGACTTGGACACATCACCAGCTGCTTGGAATAAAGAAG ATTTTCCATGGTTCGGAAAGGTAAAAGATGTGCTGCAAAATGTTTTTAAACTGCAAAAA

TTCAGACCTCTGCAGCTGGAAACCATCAATGTCACCATGGCTAGAAAGGATATCTTTCTTGTCATGCCCACAGGAGGAGGGAAGAGCTTATGCTACCAGC

TACCTGCGCTGTGCTCAGACG GTTTTACACTTGTGATTTGCCCACTCATCTCTCTTATGGAAGATCAGCTGATGGTTTTAAAACAGTTGGGAATTTCAG

CTACTATGTTGAATGCTTCCAGCTCTAAG GAACATGTAAAATGGGTGCACGCTGAAATGGTGAATAAAAACTCCCAGTTAAAGCTGATTTATGTAACTC

CAGAGAAAATTGCAAAAAGCAAGATGTTCATGTCAAGACTGGAGAAAGCCTATGAAGCCGGGAGGCTGACGGGAGCGGCAGTGGATGAAGTGCATTGCTG

CAGTCAGTGGGGTCATGACTTCAGGCCTG ATTATAAGGCTCTTGGCATCTTGAAGCGCCAGTTTCCCAACGCCTCACTGATGGGGCTGACTGCAACAGC

AACCAACCATGTTCTGAAGGATGTACAGAAAATCCTGTGTGTGGGAAAGTGTTTGACTTTTACAGCGTCTTTCAACCGGCCAAATCTTTTTTATGAG GT

TCGGCAAAAGCCCTCAAGTGCTGAAGACTTTACTGAGGACATTGTCAAGCTAATTAATGGACGGTACAAAGGACAATCAG GAATCATATACTGTTTCTC

TCAGAAAGACTCTGAACAAATTACCATCAGTTTACAGAAGTTGGGAATTCATGCAGGCACTTACCATGCCAATATGGAACCAGAAGATAAGACCAAGGTT

CATACACAGTGGTCAGCCAATGAGCTTCAG GTGGTAGTGGCAACAGTCGCATTTGGCATGGGAATTGATAAGCCAGACGTGAGGTTTGTCATCCATCAT

TCAATGAGCAAATCCATGGAGAATTACTATCAAGAGAGCGGGCGTGCCG GTCGCGATGACTCGAGAGCAGACTGTATTCTGTATTACGGCTTTGGGGAC

ATATTCAGGATCAGCTCGATGGTGGTCATGGAGAACGTGGGGCAGCAGAAGCTGTATGAGATGGTGTCATACTGCCAGAATGTCAGCAA GTGTCGCCGT

GTGTTAATAGCACAGCATTTTGATGAAGTGTGGAACGCAGATGCCTGTAACAAAATGTGTGACAACTGCTGTAAAGACGTTT - UNI12567 - CGTT

TGAGAAAAAGAATGTGACACAGCACTGCCGGGACCTGATAAAGATTCTGAAGCAGGCTGAAGGCCTGAATGAAAAGCTGACCCCGCTGAAGCTGATTGAT

GCTTGGATGGGAAAGGGAGCAGCCAAGTTGAGAGTGGCTGGCGTTGTTGCCCCGGCCCTTCCCCGGGAAGACCTGGAGAGAATCGTCGCCCACGCCCTCC

TGCAGCAATATCTCAA AGAAGACTACAGCTTCACGGCTTACGCCACCATCTCCTATCTGAAGGTGGGACCCAGAGCTTGTCTTCTCAGCAACGAAGCCC

ATGCTGTCACTATGCAAGTGAAGAAGTCAGCACAGAGCAGCGTTAGG GGTGCACTGTCTGAAGCTCGTCAGGTGGAACAAGTGGATTCGAAGGGGGAAG

AGCAAAGCTCAGGTAACTCCCAGAAGTCTAAAAGCAGGCTTCAGCCATCTGGCTCTAAGAACGCAGGCGCTAAGAAAAGAAAACTTGATGATGCTTGAGT

GTCACGTAATATTGTACAATGTAACTGTTCTGTATGTTCATGTCTGGGTCATTTTTATAATCTGCTATAATTTTTGAAACAACTTCATGTTTTATACATA

TAAAGCTGTATTTTCAGAGCTTACCTTATACAATAATGAAAAATACAACTTTTATGTAAAGTTGTCTAAATGTAATATATCTCACATTAAGTCCACATAA

CTTTTGTAAGCCCGTTCGCCTTGCTGTAACTAGCTGTCGTCTTCTGACGTGACTCTCCTTTAAAGCAGTACTATGCTGACATGGGCTCTCCTTTCCAAAT

GGGTGACATTTTAAGCTGAGCAATGTAGATGACTTCTAGTGAGAAGAGTTGCTGTTATAATTCAGATAAAACAGTCCTCAGCACCAAGTGTGTCAGCAAG

AATGGCCTGCATATTCTAAGTAAATCACGACAGCAGCCTCCTGAGGCCGCAGCCTGACTTTGACGTTCAGGCAAACAGAGGAGCTGGTGTATTTGTATGA

GTCAAGGTTTATCGTCAACTCTAGAGGAGGAGTGTTCATCTGCAAATGAGTCATTAAACGAGTTCATCTGAAGAATTTTCTTTATTTCTTTCCAACATCC

AGTCTGGTGTCTGCATTCTCTACTTGAGTGCCCATGCACTCCGTGTGGTTATGTTTCCCCATGTACTTTCTTTTCTCTTTATTTTGTACTTTGTATTCCT

GAAGAGATTTCAATTTCAATCAAAATAATCCTCTATGTCGATATTTGGATCTAGGAGATCCTCCCCGTATGATGAAAGGTCCATTTGGTTTAAGATTAAA

TTTTCAAATGTTTCCTCT
Translation
 - UNI17432 - MASVSA - UNI26967 - ALTEELESVASELHAIDIQIQELTERRQELLQRKSVLTGKIKQYLEDSSAEASSDLDTSPAAWNKE

D DFPWFGKVKDVLQNVFKLQKFRPLQLETINVTMARKDIFLVMPTGGGKSLCYQLPALCSDG GFTLVICPLISLMEDQLMVLKQLGISATMLNASSSK

 EHVKWVHAEMVNKNSQLKLIYVTPEKIAKSKMFMSRLEKAYEAGRLTGAAVDEVHCCSQWGHDFRPD DYKALGILKRQFPNASLMGLTATATNHVLKD

VQKILCVGKCLTFTASFNRPNLFYE VRQKPSSAEDFTEDIVKLINGRYKGQSG GIIYCFSQKDSEQITISLQKLGIHAGTYHANMEPEDKTKVHTQWS

ANELQ VVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAG GRDDSRADCILYYGFGDIFRISSMVVMENVGQQKLYEMVSYCQNVSK KCRRV

LIAQHFDEVWNADACNKMCDNCCKDVS - UNI12567 - SFEKKNVTQHCRDLIKILKQAEGLNEKLTPLKLIDAWMGKGAAKLRVAGVVAPALPRED

LERIVAHALLQQYLK KEDYSFTAYATISYLKVGPRACLLSNEAHAVTMQVKKSAQSSVR GALSEARQVEQVDSKGEEQSSGNSQKSKSRLQPSGSKNA

GAKKRKLDDA

For any suggestions or comments, please send an email to unitrap@crg.es