Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030257 (Srgap3)
Chromosomal location
Chr 6: 112671964 - 112897260 (-)
Description
SLIT-ROBO Rho GTPase activating protein 3 Gene [Source:MGI (curated);Acc:Srgap3-001]
RefSeq_dna
NM_080448 
RefSeq_peptide
NP_536696.4 
UniGene
Mm.236401 
MGI
MGI:2152938 
Uniprot/SWISSPROT
Q812A2 
Uniprot/SPTREMBL
Q91Z68 
Human Ortholog
ENSG00000196220 (SRGAP3)
Omim not available
UniTrap UNI25204
Vector Insertion
Chr 6: 112779432 - 112779626
Public Clones not available
Private Clones OST191796 (lexicon) OST148307 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37294
Vector Insertion
Chr 6: 112766748 - 112779432
Public Clones CMHD-GT_260C9-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32475
Vector Insertion
Chr 6: 112704564 - 112709771
Public Clones IST14951A6 (tigm) IST11466A3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29182
Vector Insertion
Chr 6: 112673196 - 112677206
Public Clones not available
Private Clones OST6501 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000060215
Sequence
AGTCCAGCCCTGGGTCCAGCGGAGCTAAAACGCTACAGCCGGGAAAACTTCCACCTCCCTCTCCTGGTTTTGATCCTCACCGTCCAGCAGACCCGAGGCG

CCGATCGACCGGAGGGAGGATGAGAGATGACCGGTCCTTTGGCAACCTGACCATTTCCTTAGCAGAGCCTTCCAAAGCGAACCGGAGACTGGCCACACGA

CCCAGGAGGCGCCGCGCCTCTTGTGGATGTGTGTGTATGAGTGAGCAAGCGGGTGTGTGTGTGTGAGTGAGGGTGTGTGTGTGTATGCGTGTGTGTGTGT

GTGTGCGCGCGTGTGTGTATGCGCGCGCTTGTGGTGTGGATGGGTGTGTGCACAGCACAATTGCGTGGAAGCGTGTCTGGGTGAGCGTGTGTGTGCACTC

GTGAATGTGTTTGTGTGTGTGTGTGTACGTGTGTGTGTGTGTTTGTGTGTGCTCTTGGCTGCTATTATTATTATTTTGGAAGAAAAATCCTGGAAATCTG

GGGCAGGTTATGGTACTCCCAGGGTGACTTCTTTTGCAAGAGGAGCTGACCAGAGCAAGCCACTAGAGCCATTTCCCTGCCAGCAGAGAGCATTTTCCTC

CCAGAAGAAGGATTTCAACCCCGGGGCTCTGTAGCCAAGTAAAAGAGATTAGCCCTTGAAACCTGTGAAATCGACCATTGCTGTGTGATTACCCAGGCTT

GGGAGAGGACTTGGAGAGAGAAGGAGAAATAGATCAAACAGCCTGTCAGTTCTCTTTGCCACGTCGGAAGATGTCATCTCAAACTAAGTTCAAGAAAGAC

AAAGAGATCATTGCTGAATATGAAGCCCAAATAAAAG - UNI25204 - AGATCCGCACGCAGCTGGTGGAGCAGTTCAAATGCCTGGAGCAGCAGTC

CGAGTCGCGGCTGCAGCTGCTGCAAGACTTGCAGGAGTTCTTCCGCAGGAAAGCTGAGATTGAGCTGGAGTATTCCCGAAGCCTGGAGAAGCTGGCTGAG

CGCTTCTCCTCCAAGATTCGCAGCTCCCGGGAGCACCAGTTCAA - UNI25204 - - UNI37294 - GAAGGATCAATACCTCCTCTCGCCCGTGA

ACTGTTGGTATCTGGTACTGCATCAGACTCGGCGGGAGAGCCGAGACCATGCCACCCTCAACGACATCTTCATGAACAATGTCATCGTCCGCCTCTCCCA

GATCAGTGAAGATGTCATCAGACTCTTCAAAAAG AGCAAAGAGATTGGCCTGCAGATGCATGAGGAGCTGCTGAAGGTCACCAACGAGCTCTACACA G

TCATGAAAACCTACCACATGTACCATGCAGAGAGCATCAGTGCAGAAAGCAAGCTGAAGGAGGCTGAGAAGCAGGAGGAGAAACAGTTTAACAAGTCAGG

AGAGCTAAGCATGAACCTGCTCCGGCACGAGGACAGACCCCAGCGCCGCAGCTCCGTGAAGAAGATTGAGAAGATGAAGGAGAAG AGGCAGGCCAAGTA

TTCTGAGAACAAGCTCAAGTGCACGAAGGCCCGGAATGATTACCTGCTGAATCTGGCAGCCACCAACGCAGCTATCAGCAAATACTACATCCACGATGTC

TCTGATCTCATCGAT TGCTGTGATTTGGGCTTTCACGCCAGCCTGGCCCGCACTTTTCGGACCTACCTCTCAGCAGAATATAACCTGGAGACCTCTCGC

CATGAGGGTCTGGACGTCATAGAGAATGCAGTGGACAACCTGGACTCCCGGAGTGACAAGCACACAGTCATGGATATGTGCAGCCAGGTCTTTTGCCCTC

CACTCAAGTTTGAGTTCCAGCCCCACATGGGGGATGAG GTCTGCCAGGTCAGTGCACAGCAGCCTGTCCAGACAGAGCTGCTCATGCGGTACCACCAGC

TGCAGTCCAGGCTGGCCACTCTCAAGATTGAGAATGAAGAG GTTCGGAAAACCCTGGATGCCACCATGCAGACCTTACAGGACATGCTGACCGTGGAAG

ACTTCGATGTCTCTGACGCCTTCCAACACAGCCGATCTACAGAGTCCATAAAGTCAGCTGCTTCTGAGACCTACATGAGCAAAATCAACATCGCCAAAAG

GAGAGCCAACCAGCAGGAAACAGAAATGTTTTATTTTACA AAATTTAAAGAATATGTGAATGGCAGTAACCTCATCACCAAGCTGCAAGCCAAGCATGA

CTTACTCAAGCAGACCCTGGGTGAAGGTGAGTTGATGCTGGAGAGCCCAAGAGGGACTACTATATGGCCTGGAGCTGCTGAGCCACCTCAGCTCATTCAG

CACCGGACAGGGAAAGACCTGATGCTGGACTCTTGTGCCTTCACTAGACAGGTTGGAAAAACTGCCTTGGTACAGGGGCTGGGATGAGTCCTGTGTGGCT

GTAAGAAAGGGCAAGGCCAAGGGGTGGATGGGTCCCCATAAGTAGGAGGTGGGACTCCAAGGACACAGGGACAAGTGTTTCTCAGCACGTCAGGAAAAGT

GTTGGAGAGCCTCACCAAGGTTCTAGATCC
Translation
MSSQTKFKKDKEIIAEYEAQIKE - UNI25204 - EIRTQLVEQFKCLEQQSESRLQLLQDLQEFFRRKAEIELEYSRSLEKLAERFSSKIRSSREHQ

FK - UNI25204 - - UNI37294 - KKDQYLLSPVNCWYLVLHQTRRESRDHATLNDIFMNNVIVRLSQISEDVIRLFKK SKEIGLQMHEELLKV

TNELYT VMKTYHMYHAESISAESKLKEAEKQEEKQFNKSGELSMNLLRHEDRPQRRSSVKKIEKMKEK RQAKYSENKLKCTKARNDYLLNLAATNAAI

SKYYIHDVSDLID CCDLGFHASLARTFRTYLSAEYNLETSRHEGLDVIENAVDNLDSRSDKHTVMDMCSQVFCPPLKFEFQPHMGDE VCQVSAQQPVQ

TELLMRYHQLQSRLATLKIENEE VRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESIKSAASETYMSKINIAKRRANQQETEMFYFT KFKEYVNGS

NLITKLQAKHDLLKQTLGEGELMLESPRGTTIWPGAAEPPQLIQHRTGKDLMLDSCAFTRQVGKTALVQGLG
Transcript ENSMUST00000113170
Sequence
ATGCCACCCTCAACGACA TTCATGAACAATGTCATCGTCCGCCTCTCCCAGATCAGTGAAGATGTCATCAGACTCTTCAAAAAG AGCAAAGAGATTGG

CCTGCAGATGCATGAGGAGCTGCTGAAGGTCACCAACGAGCTCTACACA GTCATGAAAACCTACCACATGTACCATGCAGAGAGCATCAGTGCAGAAAG

CAAGCTGAAGGAGGCTGAGAAGCAGGAGGAGAAACAGTTTAACAAGTCAGGAGAGCTAAGCATGAACCTGCTCCGGCACGAGGACAGACCCCAGCGCCGC

AGCTCCGTGAAGAAGATTGAGAAGATGAAGGAGAAG AGGCAGGCCAAGTATTCTGAGAACAAGCTCAAGTGCACGAAGGCCCGGAATGATTACCTGCTG

AATCTGGCAGCCACCAACGCAGCTATCAGCAAATACTACATCCACGATGTCTCTGATCTCATCGAT TGCTGTGATTTGGGCTTTCACGCCAGCCTGGCC

CGCACTTTTCGGACCTACCTCTCAGCAGAATATAACCTGGAGACCTCTCGCCATGAGGGTCTGGACGTCATAGAGAATGCAGTGGACAACCTGGACTCCC

GGAGTGACAAGCACACAGTCATGGATATGTGCAGCCAGGTCTTTTGCCCTCCACTCAAGTTTGAGTTCCAGCCCCACATGGGGGATGAG GTCTGCCAGG

TCAGTGCACAGCAGCCTGTCCAGACAGAGCTGCTCATGCGGTACCACCAGCTGCAGTCCAGGCTGGCCACTCTCAAGATTGAGAATGAAGAG GTTCGGA

AAACCCTGGATGCCACCATGCAGACCTTACAGGACATGCTGACCGTGGAAGACTTCGATGTCTCTGACGCCTTCCAACACAGCCGATCTACAGAGTCCAT

AAAGTCAGCTGCTTCTGAGACCTACATGAGCAAAATCAACATCGCCAAAAGGAGAGCCAACCAGCAGGAAACAGAAATGTTTTATTTTACA AAATTTAA

AGAATATGTGAATGGCAGTAACCTCATCACCAAGCTGCAAGCCAAGCATGACTTACTCAAGCAGACCCTGGGTGAAG - UNI32475 - GGGAGAGAG

CAGAGTGCGGCACGACCAG - UNI32475 - GCCCCCCTGTCTTCCCCCTAAACCACAGAAAATGAGGAGACCTAGGCCTCTTTCAGTGTATAGCCAT

AAACTCTTTAACGGCAGTATGGAAGCGTTCATTAAG - UNI32475 - GATTCAGGACAAGCTATACCACTTGTAGTTGAGAGCTGTATTCGATTCAT

CAATTTATATG GACTCCAGCAGCAGGGGATCTTCAGAGTTCCAGGGTCTCAGGTTGAAGTCAATGACATCAAGAATTCCTTTGAGAGAG GTGAAGACC

CCCTCGTGGATGACCAAAATGAGCGAGATATCAATTCAGTTGCTGGTGTTTTAAAACTGTATTTCCGAGGACTGGAAAACCCACTCTTTCCTAAGGAAAG

GTTTCAAGATTTGATATCTACTATTA AACTGGAGAACCCAGCTGACAGGGTGCACCCAATCCAGCAGATCCTCATCACCCTGCCCCGCGTGGTCATTGT

GGTCATGAGATACCTCTTTGCTTTCCTCAATCA CCTTTCCCAGTACAGTGATGAGAACATGATGGATCCCTACAACTTGGCCATCTGCTTCGGGCCCAC

CCTCATGCACATCCCCGATGGGCAGGACCCTGTATCCTGCCAGGCGCATGTCAATGAAGTCATCAAAACTATCATCATCCACCATGAAGCCATTTTCCCC

AGCCCTCGGGAGCTAGAGGGACCCGTGTACGAAAAATGCATGGCTGGAGGGGAAGAGTACTG TGACAGCCCACACAGTGAGCCGGGGACCATTGATGAA

GTTGACCATGACAATGGCACGGAGCCTCACACCAGTGACGAAG AAGTGGAGCAGATTGAGGCCATCGCCAAGTTTGACTATGTGGGGCGGTCCCCTCGT

GAACTATCCTTCAAAAAAGGGGCCTCACTACTCCTGTATCACCGTGCCTCAGAGGACTGGTGGGAGGGCCGCCACAACGGTGTAGATGGACTCATCCCTC

ATCAGTACATAGTTGTACAGGACAT GGACGATGCCTTCTCCGATAGCCTGAGCCAAAAGGCTGACAGCGAGGCCAGCAGTGGGCCACTGCTGGATGACA

AGGCCTCTTCCAAGAATGACCTCCAGTCCCCCACAGAGCACATCTCTGATTACGGCTTTGGGGGGGTGATGGGCCG AGTGCGACTACGGTCCGACGGAG

CAGCCATCCCCAGGCGCCGAAGTGGGGGCGACACACACAGCCCACCCCGGGGCTTGGGTCCCAGCATAGACACGCCACCCCGAGCTGCTGCCTGCCCCAG

CAGCCCCCACAAAATCCCCCTCAGCCGGGGACGGATCGAGAGCCCTGAGAAGAGAAGGATGGCGACTTTCGGGAGCGCTGGCAGTATCAACTACCCTGAC

AAGAAGGCGCTGACAGAAGGGCTCTCCATGAGGTCGACTTGCGGTTCCACGCGACACAGCAGCCTAGGGGACCACAAGTCCCTGGAGGCTGAGGCCCTGG

CAGAA - UNI29182 - GACATCGAGAAGACCATGAGCACCGCTCTGCATGAGTTGCGGGAACTTGAGAGACAGAACACTGTCAAGCAGGCACCAGAT

GTGGTGCTGGACACCCTGGAGCCCCTGAAGAATCCACCAGGCCCCATCAGCTCAGAGCCCGCCAGCCCCCTGCACACCATTGTCATCCGAGACCCTGATG

CTGCTATGCGCCGAAGCAGCAGCTCATCGACGGAGATGATGACCACCTTCAAGCCAGCCCTGTCAGCTCGCCTGGCTGGTGCCCAGCTGCGTCCGCCCCC

CATGCGTCCGGTCAGACCTGTGGTTCAGCACCGATCCAGCAGCAGCAGCAGCTCAGGTGTGGGCAGCCCGGCAGTGACACCCACGGAGAAGATGTTCCCT

AATAGCTCCTCGGACAAGTCTGGCACCATGTGACCTGCAGGACTGGTGACACTGCCATGGCCCACTGCAGCACACCAAGGCCTAGGGTGGCCTTAGTGGC

TTCCACTAGCTTCCCAGGGATCTCCTGGCCTTGGAGGGCAGATCCTGGAAGGTCAGCCTGGGAGGGTGTATGTCTGTGGAGAGCAGAGGCCCAGGCGTTA

GCTGCAACTCCCGCTCAGCCATGTGAATGCCACAGACCTCTTGTAGGCAAACAGACATGCCAAGGAATGCTGGAGCAAGATCAGTCCCAAGGACAGTGTT

TCCTAAGATTGAGGCAGATGCTTACCAGCTTCTCATATTGTCACTGGAAAATTATTCTCTCGATATTCTCTACATACGTATATATGTGTATGTATATAAA

TACATGCATATATACGCATATGTGTACGTATGTGTCTGTAGGTGTGTGTATATATATATATTTATGCATCTATATACATATACTAGAGAGCTGGACATAC

ACACATGCTAACTGTATATAGACGCTCCTTTTTTTTTTCTTTTTATGAAACTTAGATTTACCTCAGACCCATGCCACCAAACATCTCCCACTCTTACTTG

GTGGGATTTGCAGGGACTTCTCTGGGAGAACTTAGAGGCCCCACAGTAACTGCGAACGAAGCAATATACCACTAACCTGCAGAGACACAAAACCAGAAAC

AGTCTCCAGCTGTCTCCAGAAGTCGTGGCCTTCCAGAACAGTCTGTCTGCCCCTCAAGGAAGGGTGGGGCAGGCAGTACCCCCAAGCAGGCTGCCCCTAA

AGGTGGGGAACCCTTCATAGAAAACCCTTCACCCACCCCCCTAGAGACCCT
Translation
MPPSTT FMNNVIVRLSQISEDVIRLFKK SKEIGLQMHEELLKVTNELYT VMKTYHMYHAESISAESKLKEAEKQEEKQFNKSGELSMNLLRHEDRPQ

RRSSVKKIEKMKEK RQAKYSENKLKCTKARNDYLLNLAATNAAISKYYIHDVSDLID CCDLGFHASLARTFRTYLSAEYNLETSRHEGLDVIENAVDN

LDSRSDKHTVMDMCSQVFCPPLKFEFQPHMGDE VCQVSAQQPVQTELLMRYHQLQSRLATLKIENEE VRKTLDATMQTLQDMLTVEDFDVSDAFQHSR

STESIKSAASETYMSKINIAKRRANQQETEMFYFT KFKEYVNGSNLITKLQAKHDLLKQTLGEG - UNI32475 - GERAECGTTR - UNI32475

 - RPPCLPPKPQKMRRPRPLSVYSHKLFNGSMEAFIK - UNI32475 - DSGQAIPLVVESCIRFINLYG GLQQQGIFRVPGSQVEVNDIKNSFER

G GEDPLVDDQNERDINSVAGVLKLYFRGLENPLFPKERFQDLISTIK KLENPADRVHPIQQILITLPRVVIVVMRYLFAFLNH HLSQYSDENMMDPY

NLAICFGPTLMHIPDGQDPVSCQAHVNEVIKTIIIHHEAIFPSPRELEGPVYEKCMAGGEEYC CDSPHSEPGTIDEVDHDNGTEPHTSDEE EVEQIEA

IAKFDYVGRSPRELSFKKGASLLLYHRASEDWWEGRHNGVDGLIPHQYIVVQDM MDDAFSDSLSQKADSEASSGPLLDDKASSKNDLQSPTEHISDYGF

GGVMGR RVRLRSDGAAIPRRRSGGDTHSPPRGLGPSIDTPPRAAACPSSPHKIPLSRGRIESPEKRRMATFGSAGSINYPDKKALTEGLSMRSTCGSTR

HSSLGDHKSLEAEALAE - UNI29182 - DIEKTMSTALHELRELERQNTVKQAPDVVLDTLEPLKNPPGPISSEPASPLHTIVIRDPDAAMRRSSSS

STEMMTTFKPALSARLAGAQLRPPPMRPVRPVVQHRSSSSSSSGVGSPAVTPTEKMFPNSSSDKSGTM
Transcript ENSMUST00000113171
Sequence
GAGATCCGCACGCAGCTGGTGGAGCAGTTCAAATGCCTGGAGCAGCAGTCCGAGTCGCGGCTGCAGCTGCTGCAAGACTTGCAGGAGTTCTTCCGCAGGA

AAGCTGAGATTGAGCTGGAGTATTCCCGAAGCCTGGAGAAGCTGGCTGAGCGCTTCTCCTCCAAGATTCGCAGCTCCCGGGAGCACCAGTTCAA - UNI

25204 - - UNI37294 - GAAGGATCAATACCTCCTCTCGCCCGTGAACTGTTGGTATCTGGTACTGCATCAGACTCGGCGGGAGAGCCGAGACCAT

GCCACCCTCAACGACATCTTCATGAACAATGTCATCGTCCGCCTCTCCCAGATCAGTGAAGATGTCATCAGACTCTTCAAAAAG AGCAAAGAGATTGGC

CTGCAGATGCATGAGGAGCTGCTGAAGGTCACCAACGAGCTCTACACA GTCATGAAAACCTACCACATGTACCATGCAGAGAGCATCAGTGCAGAAAGC

AAGCTGAAGGAGGCTGAGAAGCAGGAGGAGAAACAGTTTAACAAGTCAGGAGAGCTAAGCATGAACCTGCTCCGGCACGAGGACAGACCCCAGCGCCGCA

GCTCCGTGAAGAAGATTGAGAAGATGAAGGAGAAG AGGCAGGCCAAGTATTCTGAGAACAAGCTCAAGTGCACGAAGGCCCGGAATGATTACCTGCTGA

ATCTGGCAGCCACCAACGCAGCTATCAGCAAATACTACATCCACGATGTCTCTGATCTCATCGAT TGCTGTGATTTGGGCTTTCACGCCAGCCTGGCCC

GCACTTTTCGGACCTACCTCTCAGCAGAATATAACCTGGAGACCTCTCGCCATGAGGGTCTGGACGTCATAGAGAATGCAGTGGACAACCTGGACTCCCG

GAGTGACAAGCACACAGTCATGGATATGTGCAGCCAGGTCTTTTGCCCTCCACTCAAGTTTGAGTTCCAGCCCCACATGGGGGATGAG GTCTGCCAGGT

CAGTGCACAGCAGCCTGTCCAGACAGAGCTGCTCATGCGGTACCACCAGCTGCAGTCCAGGCTGGCCACTCTCAAGATTGAGAATGAAGAG GTTCGGAA

AACCCTGGATGCCACCATGCAGACCTTACAGGACATGCTGACCGTGGAAGACTTCGATGTCTCTGACGCCTTCCAACACAGCCGATCTACAGAGTCCATA

AAGTCAGCTGCTTCTGAGACCTACATGAGCAAAATCAACATCGCCAAAAGGAGAGCCAACCAGCAGGAAACAGAAATGTTTTATTTTACA AAATTTAAA

GAATATGTGAATGGCAGTAACCTCATCACCAAGCTGCAAGCCAAGCATGACTTACTCAAGCAGACCCTGGGTGAAG - UNI32475 - GGGAGAGAGC

AGAGTGCGGCACGACCAG - UNI32475 - GCCCCCCTGTCTTCCCCCTAAACCACAGAAAATGAGGAGACCTAGGCCTCTTTCAGTGTATAGCCATA

AACTCTTTAACGGCAGTATGGAAGCGTTCATTAAG - UNI32475 - GATTCAGGACAAGCTATACCACTTGTAGTTGAGAGCTGTATTCGATTCATC

AATTTATATG GACTCCAGCAGCAGGGGATCTTCAGAGTTCCAGGGTCTCAGGTTGAAGTCAATGACATCAAGAATTCCTTTGAGAGAG GTGAAGACCC

CCTCGTGGATGACCAAAATGAGCGAGATATCAATTCAGTTGCTGGTGTTTTAAAACTGTATTTCCGAGGACTGGAAAACCCACTCTTTCCTAAGGAAAGG

TTTCAAGATTTGATATCTACTATTA AACTGGAGAACCCAGCTGACAGGGTGCACCCAATCCAGCAGATCCTCATCACCCTGCCCCGCGTGGTCATTGTG

GTCATGAGATACCTCTTTGCTTTCCTCAATCA CCTTTCCCAGTACAGTGATGAGAACATGATGGATCCCTACAACTTGGCCATCTGCTTCGGGCCCACC

CTCATGCACATCCCCGATGGGCAGGACCCTGTATCCTGCCAGGCGCATGTCAATGAAGTCATCAAAACTATCATCATCCACCATGAAGCCATTTTCCCCA

GCCCTCGGGAGCTAGAGGGACCCGTGTACGAAAAATGCATGGCTGGAGGGGAAGAGTACTG TGACAGCCCACACAGTGAGCCGGGGACCATTGATGAAG

TTGACCATGACAATGGCACGGAGCCTCACACCAGTGACGAAG AAGTGGAGCAGATTGAGGCCATCGCCAAGTTTGACTATGTGGGGCGGTCCCCTCGTG

AACTATCCTTCAAAAAAGGGGCCTCACTACTCCTGTATCACCGTGCCTCAGAGGACTGGTGGGAGGGCCGCCACAACGGTGTAGATGGACTCATCCCTCA

TCAGTACATAGTTGTACAGGACAT GGACGATGCCTTCTCCGATAGCCTGAGCCAAAAGGCTGACAGCGAGGCCAGCAGTGGGCCACTGCTGGATGACAA

GGCCTCTTCCAAGAATGACCTCCAGTCCCCCACAGAGCACATCTCTGATTACGGCTTTGGGGGGGTGATGGGCCG AGTGCGACTACGGTCCGACGGAGC

AGCCATCCCCAGGCGCCGAAGTGGGGGCGACACACACAGCCCACCCCGGGGCTTGGGTCCCAGCATAGACACGCCACCCCGAGCTGCTGCCTGCCCCAGC

AGCCCCCACAAAATCCCCCTCAGCCGGGGACGGATCGAGAGCCCTGAGAAGAGAAGGATGGCGACTTTCGGGAGCGCTGGCAGTATCAACTACCCTGACA

AGAAGGCGCTGACAGAAGGGCTCTCCATGAGGTCGACTTGCGGTTCCACGCGACACAGCAGCCTAGGGGACCACAAGTCCCTGGAGGCTGAGGCCCTGGC

AGAA - UNI29182 - GACATCGAGAAGACCATGAGCACCGCTCTGCATGAGTTGCGGGAACTTGAGAGACAGAACACTGTCAAGCAGGCACCAGATG

TGGTGCTGGACACCCTGGAGCCCCTGAAGAATCCACCAGGCCCCATCAGCTCAGAGCCCGCCAGCCCCCTGCACACCATTGTCATCCGAGACCCTGATGC

TGCTATGCGCCGAAGCAGCAGCTCATCGACGGAGATGATGACCACCTTCAAGCCAGCCCTGTCAGCTCGCCTGGCTGGTGCCCAGCTGCGTCCGCCCCCC

ATGCGTCCGGTCAGACCTGTGGTTCAGCACCGATCCAGCAGCAGCAGCAGCTCAGGTGTGGGCAGCCCGGCAGTGACACCCACGGAGAAGATGTTCCCTA

ATAGCTCCTCGGACAAGTCTGGCACCATGTGACCTGCAGGACTGGTGACACTGCCATGGCCCACTGCAGCACACCAAGGCCTAGGGTGGCCTTAGTGGCT

TCCACTAGCTTCCCAGGGATCTCCTGGCCTTGGAGGGCAGATCCTGGAAGGTCAGCCTGGGAGGGTGTATGTCTGTGGAGAGCAGAGGCCCAGGCGTTAG

CTGCAACTCCCGCTCAGCCATGTGAATGCCACAGACCTCTTGTAGGCAAACAGACATGCCAAGGAATGCTGGAGCAAGATCAGTCCCAAGGACAGTGTTT

CCTAAGATTGAGGCAGATGCTTACCAGCTTCTCATATTGTCACTGGAAAATTATTCTCTCGATATTCTCTACATACGTATATATGTGTATGTATATAAAT

ACATGCATATATACGCATATGTGTACGTATGTGTCTGTAGGTGTGTGTATATATATATATTTATGCATCTATATACATATACTAGAGAGCTGGACATACA

CACATGCTAACTGTATATAGACGCTCCTTTTTTTTTTCTTTTTATGAAACTTAGATTTACCTCAGACCCATGCCACCAAACATCTCCCACTCTTACTTGG

TGGGATTTGCAGGGACTTCTCTGGGAGAACTTAGAGGCCCCACAGTAACTGCGAACGAAGCAATATACCACTAACCTGCAGAGACACAAAACCAGAAACA

GTCTCCAGCTGTCTCCAGAAGTCGTGGCCTTCCAGAACAGTCTGTCTGCCCCTCAAGGAAGGGTGGGGCAGGCAGTACCCCCAAGCAGGCTGCCCCTAAA

GGTGGGGAACCCTTCATAGAAAACCCTTCACCCACCCCCCTAGAGACCCT
Translation
EIRTQLVEQFKCLEQQSESRLQLLQDLQEFFRRKAEIELEYSRSLEKLAERFSSKIRSSREHQFK - UNI25204 - - UNI37294 - KKDQYLLS

PVNCWYLVLHQTRRESRDHATLNDIFMNNVIVRLSQISEDVIRLFKK SKEIGLQMHEELLKVTNELYT VMKTYHMYHAESISAESKLKEAEKQEEKQF

NKSGELSMNLLRHEDRPQRRSSVKKIEKMKEK RQAKYSENKLKCTKARNDYLLNLAATNAAISKYYIHDVSDLID CCDLGFHASLARTFRTYLSAEYN

LETSRHEGLDVIENAVDNLDSRSDKHTVMDMCSQVFCPPLKFEFQPHMGDE VCQVSAQQPVQTELLMRYHQLQSRLATLKIENEE VRKTLDATMQTLQ

DMLTVEDFDVSDAFQHSRSTESIKSAASETYMSKINIAKRRANQQETEMFYFT KFKEYVNGSNLITKLQAKHDLLKQTLGEG - UNI32475 - GER

AECGTTR - UNI32475 - RPPCLPPKPQKMRRPRPLSVYSHKLFNGSMEAFIK - UNI32475 - DSGQAIPLVVESCIRFINLYG GLQQQGIF

RVPGSQVEVNDIKNSFERG GEDPLVDDQNERDINSVAGVLKLYFRGLENPLFPKERFQDLISTIK KLENPADRVHPIQQILITLPRVVIVVMRYLFAF

LNH HLSQYSDENMMDPYNLAICFGPTLMHIPDGQDPVSCQAHVNEVIKTIIIHHEAIFPSPRELEGPVYEKCMAGGEEYC CDSPHSEPGTIDEVDHDN

GTEPHTSDEE EVEQIEAIAKFDYVGRSPRELSFKKGASLLLYHRASEDWWEGRHNGVDGLIPHQYIVVQDM MDDAFSDSLSQKADSEASSGPLLDDKA

SSKNDLQSPTEHISDYGFGGVMGR RVRLRSDGAAIPRRRSGGDTHSPPRGLGPSIDTPPRAAACPSSPHKIPLSRGRIESPEKRRMATFGSAGSINYPD

KKALTEGLSMRSTCGSTRHSSLGDHKSLEAEALAE - UNI29182 - DIEKTMSTALHELRELERQNTVKQAPDVVLDTLEPLKNPPGPISSEPASPL

HTIVIRDPDAAMRRSSSSSTEMMTTFKPALSARLAGAQLRPPPMRPVRPVVQHRSSSSSSSGVGSPAVTPTEKMFPNSSSDKSGTM
Transcript ENSMUST00000113169
Sequence
ATGTCATCTCAAACTAAGTTCAAGAAAGACAAAGAGATCATTGCTGAATATGAAGCCCAAATAAAAG - UNI25204 - AGATCCGCACGCAGCTGGT

GGAGCAGTTCAAATGCCTGGAGCAGCAGTCCGAGTCGCGGCTGCAGCTGCTGCAAGACTTGCAGGAGTTCTTCCGCAGGAAAGCTGAGATTGAGCTGGAG

TATTCCCGAAGCCTGGAGAAGCTGGCTGAGCGCTTCTCCTCCAAGATTCGCAGCTCCCGGGAGCACCAGTTCAA - UNI25204 - - UNI37294 -

 GAAGGATCAATACCTCCTCTCGCCCGTGAACTGTTGGTATCTGGTACTGCATCAGACTCGGCGGGAGAGCCGAGACCATGCCACCCTCAACGACATCTT

CATGAACAATGTCATCGTCCGCCTCTCCCAGATCAGTGAAGATGTCATCAGACTCTTCAAAAAG AGCAAAGAGATTGGCCTGCAGATGCATGAGGAGCT

GCTGAAGGTCACCAACGAGCTCTACACA GTCATGAAAACCTACCACATGTACCATGCAGAGAGCATCAGTGCAGAAAGCAAGCTGAAGGAGGCTGAGAA

GCAGGAGGAGAAACAGTTTAACAAGTCAGGAGAGCTAAGCATGAACCTGCTCCGGCACGAGGACAGACCCCAGCGCCGCAGCTCCGTGAAGAAGATTGAG

AAGATGAAGGAGAAG AGGCAGGCCAAGTATTCTGAGAACAAGCTCAAGTGCACGAAGGCCCGGAATGATTACCTGCTGAATCTGGCAGCCACCAACGCA

GCTATCAGCAAATACTACATCCACGATGTCTCTGATCTCATCGAT TGCTGTGATTTGGGCTTTCACGCCAGCCTGGCCCGCACTTTTCGGACCTACCTC

TCAGCAGAATATAACCTGGAGACCTCTCGCCATGAGGGTCTGGACGTCATAGAGAATGCAGTGGACAACCTGGACTCCCGGAGTGACAAGCACACAGTCA

TGGATATGTGCAGCCAGGTCTTTTGCCCTCCACTCAAGTTTGAGTTCCAGCCCCACATGGGGGATGAG GTCTGCCAGGTCAGTGCACAGCAGCCTGTCC

AGACAGAGCTGCTCATGCGGTACCACCAGCTGCAGTCCAGGCTGGCCACTCTCAAGATTGAGAATGAAGAG GTTCGGAAAACCCTGGATGCCACCATGC

AGACCTTACAGGACATGCTGACCGTGGAAGACTTCGATGTCTCTGACGCCTTCCAACACAGCCGATCTACAGAGTCCATAAAGTCAGCTGCTTCTGAGAC

CTACATGAGCAAAATCAACATCGCCAAAAGGAGAGCCAACCAGCAGGAAACAGAAATGTTTTATTTTACA AAATTTAAAGAATATGTGAATGGCAGTAA

CCTCATCACCAAGCTGCAAGCCAAGCATGACTTACTCAAGCAGACCCTGGGTGAAG - UNI32475 - GGGAGAGAGCAGAGTGCGGCACGACCAG -

 UNI32475 - AGGAAGAAGAAATGCTCGAACCAGGAACCAG GATTCAGGACAAGCTATACCACTTGTAGTTGAGAGCTGTATTCGATTCATCAATTT

ATATG GACTCCAGCAGCAGGGGATCTTCAGAGTTCCAGGGTCTCAGGTTGAAGTCAATGACATCAAGAATTCCTTTGAGAGAG GTGAAGACCCCCTCG

TGGATGACCAAAATGAGCGAGATATCAATTCAGTTGCTGGTGTTTTAAAACTGTATTTCCGAGGACTGGAAAACCCACTCTTTCCTAAGGAAAGGTTTCA

AGATTTGATATCTACTATTA AACTGGAGAACCCAGCTGACAGGGTGCACCCAATCCAGCAGATCCTCATCACCCTGCCCCGCGTGGTCATTGTGGTCAT

GAGATACCTCTTTGCTTTCCTCAATCA CCTTTCCCAGTACAGTGATGAGAACATGATGGATCCCTACAACTTGGCCATCTGCTTCGGGCCCACCCTCAT

GCACATCCCCGATGGGCAGGACCCTGTATCCTGCCAGGCGCATGTCAATGAAGTCATCAAAACTATCATCATCCACCATGAAGCCATTTTCCCCAGCCCT

CGGGAGCTAGAGGGACCCGTGTACGAAAAATGCATGGCTGGAGGGGAAGAGTACTG TGACAGCCCACACAGTGAGCCGGGGACCATTGATGAAGTTGAC

CATGACAATGGCACGGAGCCTCACACCAGTGACGAAG AAGTGGAGCAGATTGAGGCCATCGCCAAGTTTGACTATGTGGGGCGGTCCCCTCGTGAACTA

TCCTTCAAAAAAGGGGCCTCACTACTCCTGTATCACCGTGCCTCAGAGGACTGGTGGGAGGGCCGCCACAACGGTGTAGATGGACTCATCCCTCATCAGT

ACATAGTTGTACAGGACAT GGACGATGCCTTCTCCGATAGCCTGAGCCAAAAGGCTGACAGCGAGGCCAGCAGTGGGCCACTGCTGGATGACAAGGCCT

CTTCCAAGAATGACCTCCAGTCCCCCACAGAGCACATCTCTGATTACGGCTTTGGGGGGGTGATGGGCCG AGTGCGACTACGGTCCGACGGAGCAGCCA

TCCCCAGGCGCCGAAGTGGGGGCGACACACACAGCCCACCCCGGGGCTTGGGTCCCAGCATAGACACGCCACCCCGAGCTGCTGCCTGCCCCAGCAGCCC

CCACAAAATCCCCCTCAGCCGGGGACGGATCGAGAGCCCTGAGAAGAGAAGGATGGCGACTTTCGGGAGCGCTGGCAGTATCAACTACCCTGACAAGAAG

GCGCTGACAGAAGGGCTCTCCATGAGGTCGACTTGCGGTTCCACGCGACACAGCAGCCTAGGGGACCACAAGTCCCTGGAGGCTGAGGCCCTGGCAGAA 

- UNI29182 - GACATCGAGAAGACCATGAGCACCGCTCTGCATGAGTTGCGGGAACTTGAGAGACAGAACACTGTCAAGCAGGCACCAGATGTGGTG

CTGGACACCCTGGAGCCCCTGAAGAATCCACCAGGCCCCATCAGCTCAGAGCCCGCCAGCCCCCTGCACACCATTGTCATCCGAGACCCTGATGCTGCTA

TGCGCCGAAGCAGCAGCTCATCGACGGAGATGATGACCACCTTCAAGCCAGCCCTGTCAGCTCGCCTGGCTGGTGCCCAGCTGCGTCCGCCCCCCATGCG

TCCGGTCAGACCTGTGGTTCAGCACCGATCCAGCAGCAGCAGCAGCTCAGGTGTGGGCAGCCCGGCAGTGACACCCACGGAGAAGATGTTCCCTAATAGC

TCCTCGGACAAGTCTGGCACCATGTGA
Translation
MSSQTKFKKDKEIIAEYEAQIKE - UNI25204 - EIRTQLVEQFKCLEQQSESRLQLLQDLQEFFRRKAEIELEYSRSLEKLAERFSSKIRSSREHQ

FK - UNI25204 - - UNI37294 - KKDQYLLSPVNCWYLVLHQTRRESRDHATLNDIFMNNVIVRLSQISEDVIRLFKK SKEIGLQMHEELLKV

TNELYT VMKTYHMYHAESISAESKLKEAEKQEEKQFNKSGELSMNLLRHEDRPQRRSSVKKIEKMKEK RQAKYSENKLKCTKARNDYLLNLAATNAAI

SKYYIHDVSDLID CCDLGFHASLARTFRTYLSAEYNLETSRHEGLDVIENAVDNLDSRSDKHTVMDMCSQVFCPPLKFEFQPHMGDE VCQVSAQQPVQ

TELLMRYHQLQSRLATLKIENEE VRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESIKSAASETYMSKINIAKRRANQQETEMFYFT KFKEYVNGS

NLITKLQAKHDLLKQTLGEG - UNI32475 - GERAECGTTR - UNI32475 - RGRRNARTRNQ DSGQAIPLVVESCIRFINLYG GLQQQGIF

RVPGSQVEVNDIKNSFERG GEDPLVDDQNERDINSVAGVLKLYFRGLENPLFPKERFQDLISTIK KLENPADRVHPIQQILITLPRVVIVVMRYLFAF

LNH HLSQYSDENMMDPYNLAICFGPTLMHIPDGQDPVSCQAHVNEVIKTIIIHHEAIFPSPRELEGPVYEKCMAGGEEYC CDSPHSEPGTIDEVDHDN

GTEPHTSDEE EVEQIEAIAKFDYVGRSPRELSFKKGASLLLYHRASEDWWEGRHNGVDGLIPHQYIVVQDM MDDAFSDSLSQKADSEASSGPLLDDKA

SSKNDLQSPTEHISDYGFGGVMGR RVRLRSDGAAIPRRRSGGDTHSPPRGLGPSIDTPPRAAACPSSPHKIPLSRGRIESPEKRRMATFGSAGSINYPD

KKALTEGLSMRSTCGSTRHSSLGDHKSLEAEALAE - UNI29182 - DIEKTMSTALHELRELERQNTVKQAPDVVLDTLEPLKNPPGPISSEPASPL

HTIVIRDPDAAMRRSSSSSTEMMTTFKPALSARLAGAQLRPPPMRPVRPVVQHRSSSSSSSGVGSPAVTPTEKMFPNSSSDKSGTM
Transcript ENSMUST00000088373
Sequence
GATGTCATCTCAAACTAAGTTCAAGAAAGACAAAGAGATCATTGCTGAATATGAAGCCCAAATAAAAG - UNI25204 - AGATCCGCACGCAGCTGG

TGGAGCAGTTCAAATGCCTGGAGCAGCAGTCCGAGTCGCGGCTGCAGCTGCTGCAAGACTTGCAGGAGTTCTTCCGCAGGAAAGCTGAGATTGAGCTGGA

GTATTCCCGAAGCCTGGAGAAGCTGGCTGAGCGCTTCTCCTCCAAGATTCGCAGCTCCCGGGAGCACCAGTTCAA - UNI25204 - - UNI37294 

- GAAGGATCAATACCTCCTCTCGCCCGTGAACTGTTGGTATCTGGTACTGCATCAGACTCGGCGGGAGAGCCGAGACCATGCCACCCTCAACGACATCT

TCATGAACAATGTCATCGTCCGCCTCTCCCAGATCAGTGAAGATGTCATCAGACTCTTCAAAAAG AGCAAAGAGATTGGCCTGCAGATGCATGAGGAGC

TGCTGAAGGTCACCAACGAGCTCTACACA GTCATGAAAACCTACCACATGTACCATGCAGAGAGCATCAGTGCAGAAAGCAAGCTGAAGGAGGCTGAGA

AGCAGGAGGAGAAACAGTTTAACAAGTCAGGAGAGCTAAGCATGAACCTGCTCCGGCACGAGGACAGACCCCAGCGCCGCAGCTCCGTGAAGAAGATTGA

GAAGATGAAGGAGAAG AGGCAGGCCAAGTATTCTGAGAACAAGCTCAAGTGCACGAAGGCCCGGAATGATTACCTGCTGAATCTGGCAGCCACCAACGC

AGCTATCAGCAAATACTACATCCACGATGTCTCTGATCTCATCGAT TGCTGTGATTTGGGCTTTCACGCCAGCCTGGCCCGCACTTTTCGGACCTACCT

CTCAGCAGAATATAACCTGGAGACCTCTCGCCATGAGGGTCTGGACGTCATAGAGAATGCAGTGGACAACCTGGACTCCCGGAGTGACAAGCACACAGTC

ATGGATATGTGCAGCCAGGTCTTTTGCCCTCCACTCAAGTTTGAGTTCCAGCCCCACATGGGGGATGAG GTCTGCCAGGTCAGTGCACAGCAGCCTGTC

CAGACAGAGCTGCTCATGCGGTACCACCAGCTGCAGTCCAGGCTGGCCACTCTCAAGATTGAGAATGAAGAG GTTCGGAAAACCCTGGATGCCACCATG

CAGACCTTACAGGACATGCTGACCGTGGAAGACTTCGATGTCTCTGACGCCTTCCAACACAGCCGATCTACAGAGTCCATAAAGTCAGCTGCTTCTGAGA

CCTACATGAGCAAAATCAACATCGCCAAAAGGAGAGCCAACCAGCAGGAAACAGAAATGTTTTATTTTACA AAATTTAAAGAATATGTGAATGGCAGTA

ACCTCATCACCAAGCTGCAAGCCAAGCATGACTTACTCAAGCAGACCCTGGGTGAAG - UNI32475 - GGGAGAGAGCAGAGTGCGGCACGACCAG 

- UNI32475 - GCCCCCCTGTCTTCCCCCTAAACCACAGAAAATGAGGAGACCTAGGCCTCTTTCAGTGTATAGCCATAAACTCTTTAACGGCAGTAT

GGAAGCGTTCATTAAG - UNI32475 - GATTCAGGACAAGCTATACCACTTGTAGTTGAGAGCTGTATTCGATTCATCAATTTATATG GACTCCAG

CAGCAGGGGATCTTCAGAGTTCCAGGGTCTCAGGTTGAAGTCAATGACATCAAGAATTCCTTTGAGAGAG GTGAAGACCCCCTCGTGGATGACCAAAAT

GAGCGAGATATCAATTCAGTTGCTGGTGTTTTAAAACTGTATTTCCGAGGACTGGAAAACCCACTCTTTCCTAAGGAAAGGTTTCAAGATTTGATATCTA

CTATTA AACTGGAGAACCCAGCTGACAGGGTGCACCCAATCCAGCAGATCCTCATCACCCTGCCCCGCGTGGTCATTGTGGTCATGAGATACCTCTTTG

CTTTCCTCAATCA CCTTTCCCAGTACAGTGATGAGAACATGATGGATCCCTACAACTTGGCCATCTGCTTCGGGCCCACCCTCATGCACATCCCCGATG

GGCAGGACCCTGTATCCTGCCAGGCGCATGTCAATGAAGTCATCAAAACTATCATCATCCACCATGAAGCCATTTTCCCCAGCCCTCGGGAGCTAGAGGG

ACCCGTGTACGAAAAATGCATGGCTGGAGGGGAAGAGTACTG TGACAGCCCACACAGTGAGCCGGGGACCATTGATGAAGTTGACCATGACAATGGCAC

GGAGCCTCACACCAGTGACGAAG AAGTGGAGCAGATTGAGGCCATCGCCAAGTTTGACTATGTGGGGCGGTCCCCTCGTGAACTATCCTTCAAAAAAGG

GGCCTCACTACTCCTGTATCACCGTGCCTCAGAGGACTGGTGGGAGGGCCGCCACAACGGTGTAGATGGACTCATCCCTCATCAGTACATAGTTGTACAG

GACAT GGACGATGCCTTCTCCGATAGCCTGAGCCAAAAGGCTGACAGCGAGGCCAGCAGTGGGCCACTGCTGGATGACAAGGCCTCTTCCAAGAATGAC

CTCCAGTCCCCCACAGAGCACATCTCTGATTACGGCTTTGGGGGGGTGATGGGCCG AGTGCGACTACGGTCCGACGGAGCAGCCATCCCCAGGCGCCGA

AGTGGGGGCGACACACACAGCCCACCCCGGGGCTTGGGTCCCAGCATAGACACGCCACCCCGAGCTGCTGCCTGCCCCAGCAGCCCCCACAAAATCCCCC

TCAGCCGGGGACGGATCGAGAGCCCTGAGAAGAGAAGGATGGCGACTTTCGGGAGCGCTGGCAGTATCAACTACCCTGACAAGAAGGCGCTGACAGAAGG

GCTCTCCATGAGGTCGACTTGCGGTTCCACGCGACACAGCAGCCTAGGGGACCACAAGTCCCTGGAGGCTGAGGCCCTGGCAGAA - UNI29182 - G

ACATCGAGAAGACCATGAGCACCGCTCTGCATGAGTTGCGGGAACTTGAGAGACAGAACACTGTCAAGCAGGCACCAGATGTGGTGCTGGACACCCTGGA

GCCCCTGAAGAATCCACCAGGCCCCATCAGCTCAGAGCCCGCCAGCCCCCTGCACACCATTGTCATCCGAGACCCTGATGCTGCTATGCGCCGAAGCAGC

AGCTCATCGACGGAGATGATGACCACCTTCAAGCCAGCCCTGTCAGCTCGCCTGGCTGGTGCCCAGCTGCGTCCGCCCCCCATGCGTCCGGTCAGACCTG

TGGTTCAGCACCGATCCAGCAGCAGCAGCAGCTCAGGTGTGGGCAGCCCGGCAGTGACACCCACGGAGAAGATGTTCCCTAATAGCTCCTCGGACAAGTC

TGGCACCATGTGA
Translation
MSSQTKFKKDKEIIAEYEAQIKE - UNI25204 - EIRTQLVEQFKCLEQQSESRLQLLQDLQEFFRRKAEIELEYSRSLEKLAERFSSKIRSSREHQ

FK - UNI25204 - - UNI37294 - KKDQYLLSPVNCWYLVLHQTRRESRDHATLNDIFMNNVIVRLSQISEDVIRLFKK SKEIGLQMHEELLKV

TNELYT VMKTYHMYHAESISAESKLKEAEKQEEKQFNKSGELSMNLLRHEDRPQRRSSVKKIEKMKEK RQAKYSENKLKCTKARNDYLLNLAATNAAI

SKYYIHDVSDLID CCDLGFHASLARTFRTYLSAEYNLETSRHEGLDVIENAVDNLDSRSDKHTVMDMCSQVFCPPLKFEFQPHMGDE VCQVSAQQPVQ

TELLMRYHQLQSRLATLKIENEE VRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESIKSAASETYMSKINIAKRRANQQETEMFYFT KFKEYVNGS

NLITKLQAKHDLLKQTLGEG - UNI32475 - GERAECGTTR - UNI32475 - RPPCLPPKPQKMRRPRPLSVYSHKLFNGSMEAFIK - UNI3

2475 - DSGQAIPLVVESCIRFINLYG GLQQQGIFRVPGSQVEVNDIKNSFERG GEDPLVDDQNERDINSVAGVLKLYFRGLENPLFPKERFQDLIS

TIK KLENPADRVHPIQQILITLPRVVIVVMRYLFAFLNH HLSQYSDENMMDPYNLAICFGPTLMHIPDGQDPVSCQAHVNEVIKTIIIHHEAIFPSPR

ELEGPVYEKCMAGGEEYC CDSPHSEPGTIDEVDHDNGTEPHTSDEE EVEQIEAIAKFDYVGRSPRELSFKKGASLLLYHRASEDWWEGRHNGVDGLIP

HQYIVVQDM MDDAFSDSLSQKADSEASSGPLLDDKASSKNDLQSPTEHISDYGFGGVMGR RVRLRSDGAAIPRRRSGGDTHSPPRGLGPSIDTPPRAA

ACPSSPHKIPLSRGRIESPEKRRMATFGSAGSINYPDKKALTEGLSMRSTCGSTRHSSLGDHKSLEAEALAE - UNI29182 - DIEKTMSTALHELR

ELERQNTVKQAPDVVLDTLEPLKNPPGPISSEPASPLHTIVIRDPDAAMRRSSSSSTEMMTTFKPALSARLAGAQLRPPPMRPVRPVVQHRSSSSSSSGV

GSPAVTPTEKMFPNSSSDKSGTM

For any suggestions or comments, please send an email to unitrap@crg.es