Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030263 (Lrmp)
Chromosomal location
Chr 6: 145070300 - 145123448 (+)
Description
lymphoid-restricted membrane protein Gene [Source:MGI (curated);Acc:Lrmp-001]
RefSeq_dna
NM_008511 
RefSeq_peptide
NP_032537.3 
MGI
MGI:108424 
Uniprot/SWISSPROT
Q60664 
Uniprot/SPTREMBL
B2KFB5 B2KFB6 B2KFB7 Q3TGD7 Q3TL84 Q3TVR1 Q3U560 Q3U583 Q3V325 Q3V3H7 Q675B6 Q8BNX8 
Human Ortholog
ENSG00000118308 (LRMP)
Omim not available
UniTrap UNI34342
Vector Insertion
Chr 6: 145070627 - 145085979
Public Clones IST14882D3 (tigm) IST12408C12 (tigm) IST11714E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22658
Vector Insertion
Chr 6: 145086128 - 145086701
Public Clones not available
Private Clones OST288726 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22731
Vector Insertion
Chr 6: 145096203 - 145096299
Public Clones not available
Private Clones OST286168 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24086
Vector Insertion
Chr 6: 145109538 - 145113716
Public Clones not available
Private Clones OST235370 (lexicon)
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37051
Vector Insertion
Chr 6: 145122332 - 145122956
Public Clones CMHD-GT_509C8-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000032396
Sequence
AAGTTGCTTCTAGGGACTCTCTGGGTGGAAGGATCTGGGCCTGCTGCGCCCGCCCGTGCAAACAGAATTGCAGAAGTTGAGCCTACGCTTATCATTTCCC

TGAGAAGAAAAGCATATTTCCAGTTTCCTGTGCCTAAGAACAAGCATCCAGCGCCCTTCCCGCGGCTCAAACCCAGGCTGACCTGTGCATATGGGTCAGG

GGGATCAGGATGGGGCCTGCGCATGAGGCAAGCCTCTGCTACAAGAACTAGAGGAAGCGATTCCAGAAGGAGATCACAGTCCCCAGCACTACTCAGACTC

AGGAGCTGAAGACCAGGGGCGTTCAGT - UNI34342 - ATGCCTGTGTCTTGACGGCCTCACAGCAATTCCAAGGCTAGAACTGACACCCATCTCAT

GTGCCAGAAACTCAGCCCATGCTCTGTGTAAAAGGTCCCCCAGAGCAGGAACCAGAAGATGGGGCTTTGGACGTGACAAGAGGGTGCCA - UNI22658

 - GTGCCCACTCCCCACGGAAGGCTCCATCTTGGGACAGGAGCTTCTAGACTGTACCAGAATGAACGAGGACCAGAGTACAGAC GAGAATGGTGCTGA

CCACTTGTATTCCGAGAGCCCGTCACAGCTCAG - UNI22731 - GGAGTATCTCACACAGCCATCGTCTGAACAGACTTCATCCTCGGAGAGCACTG

TGACGTCAAGTG AGTCTGGATCAGACATTTTGCACATGGCTTCTGGTGACCTTGACTGCAAACCTCTCTGTGAGAAGGAGGAGGAAGCAAGAGCCGCCT

CTGCCATGCAAG GCACCAGCCTAGCTCCTGCTGCTTATGGAGACTACACGAGTGTGGGCGTGGCCAAGGCTGCATCCCAGCTG GAAGCAGGAGAGGAA

CTCAGAACCACAGAAAACGGAGGGAAGGGCAGTGCCCCGGGAG AGACGGAGATTTCCATGCCCCCCAAAGCATCTGTGAAGCTCGTTAACTTTCAGCAG

AGTGAAAA CACTTCAGCTAATGAGAAGGAAGTGGAG GCAGAGTTCCTCAGGTTATCTTTGGGACTTAAGTGTGACTGGTTTACATTGGAGAAGAGGGT

GAAGCTTGAAGAGAGGTCCCGGGACCTGGCAGAGGAAAATTTGAAGAAAGAAATCACAAACTGTTTAAAGCTTTTAGAG - UNI24086 - TCGCTGA

CTCCCCTGTGTGAAGAGGACAACCAGGCTCAGGAAATCGTTAAGAAGCTGGAGAAGAGTATAGTACTGCTCAGCCAGTGCACAGCCCGAGTGGCCAGCAG

GGCTGAGATGCTGGGCGCCATCAACCAG GAAAGCCGGGTGAGTAGAGCGGTGGAGGTGATGATCCAGCACGTGGAGAACCTGAAGCGGATGTACGCCAA

AGAGCACGCAGAGCTGGAGGATCTGAAGCAAGCACTGCTGCAGAACGACAGGTCTTTTAACTCTCTGCCAGATGAAG ATGACTGTCAGATTAAAAAGCG

TTCATCTTCTCTAAATTCCAAG CCATCTTCTCTTCGAAGAGTGACCATTGCCTCTTTGCCCAGGAATCTTGGAAATGTGGGGCTG GTGTCAGGCATGG

AAAATAATGACAGATTCAGCCGGCGGTCGAGCAGCTG GAGAATCCTGGGGACAAAGCAGGGTGAGCACCGCCCCTCGCTGCATCGCTTCATCAGCACCT

ATTCCTGGGCCGACGCTGAGGACGAGAGAAGTGACGTGAA AGCCAGAGACGCCCCAGAACCACAAGGCGAAGAGGCAGTGGAGGGGACCAGGAAGCCCA

GCCTTTCTGAGAGGAGAAGCAGCACATTGGCCTGGGACAGGGGCACAAT - UNI37051 - CTGCAGCTCAGTGGCTTCCTGGGTCACTCACCTGCAG

GCGTCCTTCAGAAGAGCCAACAGAGCACTCTGGCTCACGGGGCTCATCATCATACTGATCGCAGCGCTGATGAGCTTCCTCACAGGTCAGCTCTTCCAGA

CAGCCGTGGAGGCTGCGCCCACACAGGAGGGGGACTCCTGGCTGTCTCTAGAACACATCTTATGGCCATTTACCAGACTCGGGCATGATGGACCACTGCC

AGTGTGACTGACGTGCAGCTCAATGTACCCTTGGATTTTAACGTTTCCTTCTGAGATTTGTAAATTGGTAACTTTTTTTTAGTAACTATAGTGCAAAGCT

AGGGTCCTCAGCAGCTGGGATCTTTTTATTCCCCAACAAAAGCACAGGGGACTACAAAAGGGAGGGGACCCCACCTAGGGTATTTTAATGAGCTTTCTGA

GTGAGAGGCATCAGACTTTATTGAGATGTATCCAAATAAAGACCATTCAAATCTT
Translation
 - UNI34342 - MLCVKGPPEQEPEDGALDVTRGCQ - UNI22658 - QCPLPTEGSILGQELLDCTRMNEDQSTD ENGADHLYSESPSQLR - 

UNI22731 - REYLTQPSSEQTSSSESTVTSSE ESGSDILHMASGDLDCKPLCEKEEEARAASAMQG GTSLAPAAYGDYTSVGVAKAASQL EAGEE

LRTTENGGKGSAPGE ETEISMPPKASVKLVNFQQSEN NTSANEKEVE AEFLRLSLGLKCDWFTLEKRVKLEERSRDLAEENLKKEITNCLKLLE - 

UNI24086 - SLTPLCEEDNQAQEIVKKLEKSIVLLSQCTARVASRAEMLGAINQ ESRVSRAVEVMIQHVENLKRMYAKEHAELEDLKQALLQNDRSF

NSLPDED DDCQIKKRSSSLNSK PSSLRRVTIASLPRNLGNVGL VSGMENNDRFSRRSSSW WRILGTKQGEHRPSLHRFISTYSWADAEDERSDVK 

KARDAPEPQGEEAVEGTRKPSLSERRSSTLAWDRGTI - UNI37051 - ICSSVASWVTHLQASFRRANRALWLTGLIIILIAALMSFLTGQLFQTAV

EAAPTQEGDSWLSLEHILWPFTRLGHDGPLPV

For any suggestions or comments, please send an email to unitrap@crg.es