Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030278 (Cidec)
Chromosomal location
Chr 6: 113374628 - 113385754 (-)
Description
cell death-inducing DFFA-like effector c Gene [Source:MGI (curated);Acc:Cidec-001]
RefSeq_dna
NM_178373 
RefSeq_peptide
NP_848460.1 
UniGene
Mm.10026 
MGI
MGI:95585 
Uniprot/SWISSPROT
P56198 
Uniprot/SPTREMBL
Q499X5 
Human Ortholog
ENSG00000187288 (CIDEC)
Omim not available
UniTrap UNI23576
Vector Insertion
Chr 6: 113384428 - 113384507
Public Clones not available
Private Clones OST252687 (lexicon) OST180150 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26330
Vector Insertion
Chr 6: 113383208 - 113384428
Public Clones not available
Private Clones OST124873 (lexicon) OST55401 (lexicon) OST55355 (lexicon) OST53275 (lexicon)
OST52807 (lexicon) OST51005 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27696
Vector Insertion
Chr 6: 113378548 - 113383053
Public Clones IST14341E8 (tigm)
Private Clones OST52932 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113089
Sequence
GTGCCTGGCCACGCGGTATTGCCAGGAGGCTGGGAGGTGAGGGGGAG - UNI23576 - GTCCAACACAATCCAACTGACAAGGATGGACTACGCCAT

GAAGTCTCTCAGCCTCCTGTACCCCAGGTCGCTGTCCAG - UNI23576 - - UNI26330 - GCATGTGGCAGTGAGCACGGCAGTGGTGACCCAA

CAGCTGGTGTCTAAGCCCAGCCGGGAGACCCCGAGGGCCAGGCCCTGTCGTGTTAGCACCGCAGATCGGAAGGTTCGCAAAGGCATCATGGCTCACAGCT

TGGAGGACCTCCTGAACAAG - UNI27696 - GTCCAGGACATCTTGAAACTTAAAGACAAGCCCTTCTCCCTGGTGCTGGAGGAAGATGGCACAATC

GTGGAGACAGAAGAATACTTCCAAGCCCTGGCAAAAGATACCATGTTCATGGTCCTGCTGAAGGGGCAGAAGTGGAAGCCCCCATCAGAACAG CGCAAG

AAGAGAGCCCAGCTAGCCCTTTCCCAGAAGCCAACTAAGAAGATCGATGTGGCCCGGGTAACCTTCGACCTGTACAAGCTGAACCCTCAGGACTTTATTG

GCTGCCTGAACGTGAAGGCAACCCTCTATGACACATACTCGCTTTCCTATGACCTGCACTGCTACAAGGCCAAGCGCATCGTGAA GGAGATGCTCCGCT

GGACCCTCTTCAGCATGCAGGCCACCGGTCACATGCTGCTTGGCACCTCCAGCTACATGCAGCAGTTCCTGGATGCCACCGAGGAAGAACAGCCTGCCAA

GGCCAAGCCCTCCTCCCTCCTCCCAGCCTGTCTGAAGATGCTGCAATGAAGACCCGAGTCCTCAGAGGCCTTCCTTGGGCCATGGATGTGACCGGGGACC

CTGCGCTCGGCTAGCAGCACCCATGAGCCTGGCAGCCAGACAGCTTCTCACCTGCCTGCGCCTCCCTCACAGCACAGCACCAAGGAAATTGCAGGAAGGG

CTGGAGCCCTGGGGTGGGCTGGTCACAGGAGGACTTCCTAGCCTGGCCCAGTTCCTTCCTTTCTGTCTCAGGTAGCTTAGAGGACTAACACTTAGCCCTG

GCAGGCACAAAGTCTGCCCCTGTGTCCACTTGTGCCGTCTTCCGTGCCACTCCCTCTCTGGTGCACCCCACCATCCCCGGTCCTGGCTGCCCACACTCAT

CATGCAGTAGACATTATTATGGTGGCCCCCATCATACCTTGGCCTGAATCAAGACAACCAAGCGAGCAGCATGCCACAGCACCAACTATGTCTATGACCA

TGGTGCCAGAGTGGTTAGCACTCTGTAGTAGAAGAAAAGGAGGTGGGGGCTTCGGGGGTCTCTCACCTGGGACTCTGATCACTCCCTCCTAGCCCCCAGC

TGCACATGATCATGAGGTGTGCGAGAGAGTGTTAGAGGTGGAGATTAACTAAAGCCGGCATGCCAGGGATGCAGATCTGGGGGGTCCTCACCTGTGCCAG

GGATGCAGATCTGGGGGGTCCTCACCTGTGCCAGGGAGGGACCTTAGGGAATGCAGATGATTCTGAGTCACCCAGGCCCCTCCTGTAAGTAACCTAAAAG

CTCATAGATTCACCAAGCTGGACTTGGGTGAAACCGCGGCTTAGCCTCTCATTGCCTGAATGGACACAGTTCCTGTTCTCCTGGGAAAGGCATGCAGCTG

CCTCTCTTGTTCTCATTTTTCCACGAATGAGTGAATGGTATTAGAGTCTGCAGTAAACTATTTATGCTGATACCTCA
Translation
 - UNI23576 - MDYAMKSLSLLYPRSLSR - UNI23576 - - UNI26330 - RHVAVSTAVVTQQLVSKPSRETPRARPCRVSTADRKVRKGI

MAHSLEDLLNK - UNI27696 - VQDILKLKDKPFSLVLEEDGTIVETEEYFQALAKDTMFMVLLKGQKWKPPSEQ RKKRAQLALSQKPTKKIDVAR

VTFDLYKLNPQDFIGCLNVKATLYDTYSLSYDLHCYKAKRIVK KEMLRWTLFSMQATGHMLLGTSSYMQQFLDATEEEQPAKAKPSSLLPACLKMLQ
Transcript ENSMUST00000032416
Sequence
TGGCCACGCGGTATTGCCAGGAGGCTGGGAG - UNI23576 - GTCCAACACAATCCAACTGACAAGGATGGACTACGCCATGAAGTCTCTCAGCCTC

CTGTACCCCAGGTCGCTGTCCAG - UNI23576 - - UNI26330 - GCATGTGGCAGTGAGCACGGCAGTGGTGACCCAACAGCTGGTGTCTAAGC

CCAGCCGGGAGACCCCGAGGGCCAGGCCCTGTCGTGTTAGCACCGCAGATCGGAAGGTTCGCAAAGGCATCATGGCTCACAGCTTGGAGGACCTCCTGAA

CAAG - UNI27696 - GTCCAGGACATCTTGAAACTTAAAGACAAGCCCTTCTCCCTGGTGCTGGAGGAAGATGGCACAATCGTGGAGACAGAAGAAT

ACTTCCAAGCCCTGGCAAAAGATACCATGTTCATGGTCCTGCTGAAGGGGCAGAAGTGGAAGCCCCCATCAGAACAG CGCAAGAAGAGAGCCCAGCTAG

CCCTTTCCCAGAAGCCAACTAAGAAGATCGATGTGGCCCGGGTAACCTTCGACCTGTACAAGCTGAACCCTCAGGACTTTATTGGCTGCCTGAACGTGAA

GGCAACCCTCTATGACACATACTCGCTTTCCTATGACCTGCACTGCTACAAGGCCAAGCGCATCGTGAA GGAGATGCTCCGCTGGACCCTCTTCAGCAT

GCAGGCCACCGGTCACATGCTGCTTGGCACCTCCAGCTACATGCAGCAGTTCCTGGATGCCACCGAGGAAGAACAGCCTGCCAAGGCCAAGCCCTCCTCC

CTCCTCCCAGCCTGTCTGAAGATGCTGCAATGAAGACCCGAGTCCTCAGAGGCCTTCCTTGGGCCATGGATGTGACCGGGGACCCTGCGCTCGGCTAGCA

GCACCCATGAGCCTGGCAGCCAGACAGCTTCTCACCTGCCTGCGCCTCCCTCACAGCACAGCACCAAGGAAATTGCAGGAAGGGCTGGAGCCCTGGGGTG

GGCTGGTCACAGGAGGACTTCCTAGCCTGGCCCAGTTCCTTCCTTTCTGTCTCAGGTAGCTTAGAGGACTAACACTTAGCCCTGGCAGGCACAAAGTCTG

CCCCTGTGTCCACTTGTGCCGTCTTCCGTGCCACTCCCTCTCTGGTGCACCCCACCATCCCCGGTCCTGGCTGCCCACACTCATCATGCAGTAGACATTA

TTATGGTGGCCCCCATCATACCTTGGCCTGAATCAAGACAACCAAGCGAGCAGCATGCCACAGCACCAACTATGTCTATGACCATGGTGCCAGAGTGGTT

AGCACTCTGTAGTAGAAGAAAAGGAGGTGGGGGCTTCGGGGGTCTCTCACCTGGGACTCTGATCACTCCCTCCTAGCCCCCAGCTGCACATGATCATGAG

GTGTGCGAGAGAGTGTTAGAGGTGGAGATTAACTAAAGCCGGCATGCCAGGGATGCAGATCTGGGGGGTCCTCACCTGTGCCAGGGATGCAGATCTGGGG

GGTCCTCACCTGTGCCAGGGAGGGACCTTAGGGAATGCAGATGATTCTGAGTCACCCAGGCCCCTCCTGTAAGTAACCTAAAAGCTCATAGATTCACCAA

GCTGGACTTGGGTGAAACCGCGGCTTAGCCTCTCATTGCCTGAATGGACACAGTTCCTGTTCTCCTGGGAAAGGCATGCAGCTGCCTCTCTTGTTCTCAT

TTTTCCACGAATGAGTGAATGGTATTAGAGTCTGCAGTAAACTATTTATGCTGATACCT
Translation
 - UNI23576 - MDYAMKSLSLLYPRSLSR - UNI23576 - - UNI26330 - RHVAVSTAVVTQQLVSKPSRETPRARPCRVSTADRKVRKGI

MAHSLEDLLNK - UNI27696 - VQDILKLKDKPFSLVLEEDGTIVETEEYFQALAKDTMFMVLLKGQKWKPPSEQ RKKRAQLALSQKPTKKIDVAR

VTFDLYKLNPQDFIGCLNVKATLYDTYSLSYDLHCYKAKRIVK KEMLRWTLFSMQATGHMLLGTSSYMQQFLDATEEEQPAKAKPSSLLPACLKMLQ
Transcript ENSMUST00000113091
Sequence
AGTGTGACCACAGCTTGGGTCGGAGAAACAATGGA - UNI23576 - GTCCAACACAATCCAACTGACAAGGATGGACTACGCCATGAAGTCTCTCAG

CCTCCTGTACCCCAGGTCGCTGTCCAG - UNI23576 - - UNI26330 - GCATGTGGCAGTGAGCACGGCAGTGGTGACCCAACAGCTGGTGTCT

AAGCCCAGCCGGGAGACCCCGAGGGCCAGGCCCTGTCGTGTTAGCACCGCAGATCGGAAGGTTCGCAAAGGCATCATGGCTCACAGCTTGGAGGACCTCC

TGAACAAG - UNI27696 - GTCCAGGACATCTTGAAACTTAAAGACAAGCCCTTCTCCCTGGTGCTGGAGGAAGATGGCACAATCGTGGAGACAGAA

GAATACTTCCAAGCCCTGGCAAAAGATACCATGTTCATGGTCCTGCTGAAGGGGCAGAAGTGGAAGCCCCCATCAGAACAG CGCAAGAAGAGAGCCCAG

CTAGCCCTTTCCCAGAAGCCAACTAAGAAGATCGATGTGGCCCGGGTAACCTTCGACCTGTACAAGCTGAACCCTCAGGACTTTATTGGCTGCCTGAACG

TGAAGGCAACCCTCTATGACACATACTCGCTTTCCTATGACCTGCACTGCTACAAGGCCAAGCGCATCGTGAA GGAGATGCTCCGCTGGACCCTCTTCA

GCATGCAGGCCACCGGTCACATGCTGCTTGGCACCTCCAGCTACATGCAGCAGTTCCTGGATGCCACCGAGGAAGAACAGCCTGCCAAGGCCAAGCCCTC

CTCCCTCCTCCCAGCCTGTCTGAAGATGCTGCAATGAAGACC
Translation
ME - UNI23576 - ESNTIQLTRMDYAMKSLSLLYPRSLSR - UNI23576 - - UNI26330 - RHVAVSTAVVTQQLVSKPSRETPRARPCRV

STADRKVRKGIMAHSLEDLLNK - UNI27696 - VQDILKLKDKPFSLVLEEDGTIVETEEYFQALAKDTMFMVLLKGQKWKPPSEQ RKKRAQLALS

QKPTKKIDVARVTFDLYKLNPQDFIGCLNVKATLYDTYSLSYDLHCYKAKRIVK KEMLRWTLFSMQATGHMLLGTSSYMQQFLDATEEEQPAKAKPSSL

LPACLKMLQ

For any suggestions or comments, please send an email to unitrap@crg.es