Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030284 (Creld1)
Chromosomal location
Chr 6: 113433554 - 113443333 (+)
Description
cysteine-rich with EGF-like domains 1 Gene [Source:MGI (curated);Acc:Creld1-001]
RefSeq_dna
NM_133930 
RefSeq_peptide
NP_598691.1 
UniGene
Mm.41593 Mm.409781 
MGI
MGI:2152539 
Uniprot/SWISSPROT
Q91XD7 
Uniprot/SPTREMBL
A8C1T7 
Human Ortholog
ENSG00000163703 (CRELD1)
Omim 600309 - ATRIOVENTRICULAR SEPTAL DEFECT  606217 - ATRIOVENTRICULAR SEPTAL DEFECT, SUSCEPTIBILITY TO, 2  
UniTrap UNI10633
Vector Insertion
Chr 6: 113434071 - 113434488
Public Clones M117A03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10546
Vector Insertion
Chr 6: 113434572 - 113438064
Public Clones G077G08 (ggtc) G046B01 (ggtc) M090B02 (ggtc) G046E05 (ggtc) IST10055B6 (tigm)
IST12094F8 (tigm) IST13438C4 (tigm) IST14872H5 (tigm) IST10316G2 (tigm)
IST12094C4BBF1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11155
Vector Insertion
Chr 6: 113439785 - 113441646
Public Clones G057D08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28049
Vector Insertion
Chr 6: 113441731 - 113441887
Public Clones not available
Private Clones OST41405 (lexicon)
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000032422
Sequence
CTTTCTCTCGGAATATTTTGGGATCCAACCCTCTCTCTAATTTTGGCCCCTAATAACTCACTGAGACCCTAAAACAATGGGCTGACGCTTATTCTTTTGC

CCGCGATCCCGGCCACCTCCCCCTACGGTAACGGAGAAATAATTTCTCTGCTGGAATCGTAGATTAGGCTCTTTCACCCCTTCCAGCGCCTCTGCTTCCA

CTACCCCAGTTTATCCTCGTTTTGTAATTACGTAGGTCTGGGGCTCTGAGCCCCAAGGCGCCTCGCTTTCCTCCCTTACAGCCTGGCTTCTCCAGTGAAC

CCTCCCCCTGCCCTCTATCTGCACGTCCCCAGCCTGGGAAAAGATGGCTCCACTGCCCCCAAGGGGCCTGGTCCCATCTCTGCTCTGGTGCTTGAGCCTG

TTTCTGAGCCTCCCAGGACCTGTCTGGCTCCAACCCTCTCCTCCTCCCCATCCTTCTCCCCGAGCTGAGCCCCATCCGTGTCATACCTGCCGGGCACTGG

TGGACAACTTCAACAAG - UNI10633 - GGCCTGGAGAGAACCATCCGGGACAACTTCGGGGGTGGAAACACGGCCTGGGAGGAAGAGAAGTTGTCC

AAATACAAAGACAG - UNI10546 - TGAGACCCGCCTGGTGGAGGTGCTGGAGGGCGTGTGCAGCAGGTCAGACTTCGAGTGCCACCGCCTGCTCGA

GCTGAGCGAGGAGCTGGTGGAAAACTGGTGGTTTCACAG GCAGCAGGAAGCCCCCGACCTCTTCCAGTGGCTCTGTTCCGATTCCCTGAAGCTCTGCTG

CCCCTCTGGCACCTTTGGGCCCTCCTGCCTGC CATGTCCTGGGGGCACAGAGAGGCCCTGCGGTGGCTACGGGCAGTGTGAAGGGGAAGGGACTCGAGG

GGGCAGCGGGCACTGTGACTGCCAAGCCGGCTATGGGGGCGAGGCCTGTGGCCAGTGTGGCCTTGGCTACTTTGAGGCGGAGCGCAACAGCAGCCATCTG

GTATGTTCGG CGTGTTTTGGTCCTTGTGCCCGCTGCACGGGACCTGAGGAATCCCATTGTCTGCAGTGCAAGAAAGGCTGGGCCCTGCATCACCTCAAG

TGTGTAG - UNI11155 - ACATCGATGAGTGTGGTACAGAGCAAGCCACCTGTGGAGCTGACCAGTTCTGTGTGAACACAGAAGGATCCTACGAGTG

CCGAG - UNI28049 - ACTGTGCAAAGGCCTGCCTGGGCTGTATGGGAGCAGGGCCAGGGCGCTGCAAAAAGTGCAGCCGTGGCTACCAGCAGGTGG

GCTCCAAGTGCCTAG ATGTGGATGAGTGTGAGACTGTGGTGTGTCCAGGAGAGAATGAGAAGTGTGAAAACACGGAGGGAGGCTACCGCTGTGTCTGTG

CTGAGGGCTACAGACAGGAGGACGGCATCTGCGTGAAGGAGCAGGTCCCGG AGTCGGCGGGCTTCTTTGCGGAGATGACGGAGGATGAAATGGTGGTTC

TGCAGCAGATGTTCTTTGGTGTAATCATCTGTGCGCTGGCCACGCTTGCTGCCAAGGGTGACTTGGTGTTCACTGCCATCTTCATTGGAGCTGTGGCAGC

CATGACTGGGTACTGGTTGTCAGAGCGGAGTGACCGTGTGCTGGAGGGCTTCATCAAGGGTAGATAATCCCTGCCGCCACTCACAGGATTTCCTCCCACC

CAGGCTGCTCCTAGAGGTTATTTCTCTCTCCCTATGGATACCTGGGACAGCATAGTTTCTCTTTGAGACTGGGGTAAACACCCTTTTACCTGCCTTACTG

AGCAGCCCAGGACCCCAGTGGCCCCAGGGGGTTGAAAAAGAGGTCCTGAAGCAGATGCCACGAGATCCTAGCCTAGGACACTGGCAGGCCTCACCGTGTA

TGAATCCCAAGACAGTTTCTCCCCAGGGAGGTTGCAGGTGGGCTTTGGCCCCTGACCCGGATGAGAGGTGTCCCCTCAGGGGTGGGCCCCCATAGGCCCC

TTGCCAGGTGCATGCTGCCAGCTCCAGCTGTGTATTCACCGCCCACGCCCTAGCCATCGACTTATTTATTCATCTCAGGAAATAAAGGACGGTCTTGAAA

ATGGG
Translation
MAPLPPRGLVPSLLWCLSLFLSLPGPVWLQPSPPPHPSPRAEPHPCHTCRALVDNFNK - UNI10633 - GLERTIRDNFGGGNTAWEEEKLSKYKDS

 - UNI10546 - SETRLVEVLEGVCSRSDFECHRLLELSEELVENWWFHR RQQEAPDLFQWLCSDSLKLCCPSGTFGPSCLP PCPGGTERPCGGYG

QCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNSSHLVCSA ACFGPCARCTGPEESHCLQCKKGWALHHLKCVD - UNI11155 - DIDECG

TEQATCGADQFCVNTEGSYECRD - UNI28049 - DCAKACLGCMGAGPGRCKKCSRGYQQVGSKCLD DVDECETVVCPGENEKCENTEGGYRCVCA

EGYRQEDGICVKEQVPE ESAGFFAEMTEDEMVVLQQMFFGVIICALATLAAKGDLVFTAIFIGAVAAMTGYWLSERSDRVLEGFIKGR

For any suggestions or comments, please send an email to unitrap@crg.es