Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030303 (Mlstd1)
Chromosomal location
Chr 6: 147995781 - 148131282 (+)
Description
fatty acyl CoA reductase 2 Gene [Source:MGI (curated);Acc:Mlstd1-002]
Human Ortholog
not available
Omim not available
UniTrap UNI36581
Vector Insertion
Chr 6: 147996035 - 148087057
Public Clones IST10440E11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111607
Sequence
GAGAGCAGAGGCGCGGTTCAGAAAAGCTCGAGTGCCTCCTTCATCTCCGGGAGGACCGTGACCACCAGCCGGCAAGTCAACCGCACTGAAGCAGCAG - 

UNI36581 - GACTCTCTTCCCAGAACCATACAGGAACGGAGGAATCATGTCCATGATCGCAGCTTTCTACAGCAACAAGTCTATCCTCATCACAGGGG

CCACAGGCTTCCTGGGCAAGGTGCTCATGGAGAAGTTATTCCGTACCAGCCCCCACTTGAAAGTCATTTACATCCTCGTGAGACCCAAGTCTGGACAGAC

ACTGCAGGAAAGGGTTTTCCAGATCCTCAACAGTAAG CTGTTTGAGAAAGTCAAAGAAGTCTGTCCAAATGTGCATGAGAAGATCAGACCCATCTCCGC

AGACCTCAACCAGCGTGACTTCGCCATCAGCAAGGAAGACGTGCAAGAACTTCTGTCCTGTACCAATATTATCTTCCACTGTGCAGCCACAGTGCGCTTT

GATGCACATCTGAG AGAAGCTGTGCAGCTGAACGTCACGGCCACCCAGCAGCTCCTGCTAATGGCCAGCCAGATGCCAAAGCTGGAAGCCTTCATCCAC

ATCTCCACTGCCTTTTCCAACTGCAACCTGAGCCACATTGATGAGGTCATCTACCCATGCCCTGTGGAGCCAAGAAAGATCATTGACTCCATGGA GTGG

TTAGATGACTCTATCATTGAAGAGATCACTCCTAAGCTGATTGGGGACCGGCCCAATACCTACACCTACACCAAAGCCTTGGGAGAGATAGTAGTGCAGC

AAGAGAGCGGAAACCTGAATGTGGCCATTGTCAGGCCATCCATAGTGGGAGCAACCTGGCAGGAGCCTTTCCCG GGTTGGGTTGATAATCTAAATGGAC

CCAGCGGACTCATTATTGCG ACTGGGAAAGGATTTCTTCGGTCCATAAAAGCGACTCCCATGGCAGTGGCAGATGTGATTCCAGTTGACACAGTTGTTA

ATCTCACCATAGCAGTAGGATGGTATACTGCAGTTCATAG GCCTAAATCAACATTAATCTACCATTCCACATCTGGTAATCTCAATCCCTGTAACTGGT

ATAAAATGG GATTACAGGTCTTGGCGACCATCGAAAAGATCCCATTTGAGAGTGCTTTCAGAAGGCCAAATGCTGACTTCACCACCAGCAATTTCACCA

CCCATTATTGGAACACCGTCAGCCACCGGGTCCCAGCCATCATCTATGACTTCTATCTGAGGCTTACTGGAAGGAAACCCAG AATGCTGAAGCTCATGA

ACCGGCTGCTAAAAACCATTTCCATGCTGGAGTATTTCATCAACCACAGTTGGGAATGGAGCACAAACAACACGGAGATGCTTCTGTCAGAGCTCAGTCC

TGAAGACCAGAGA GTATTCAACTTTGATGTGCGTCAGTTGAACTGGCTCGAATACATTGAAAATTACGTTTTGGGGGTTAAGAAGTATCTACTAAAAGA

GGATCTGGCCGGTATCCCCAAAGCAAAGCAACACCTAAGAAG GCTCCGGAACATTCACTACCTCTTTAACACTGCCCTGTTTCTTATCATCTGGCGCCT

CCTCATTGCAAGGTCTCAGATGGCTCGGAACGTCTGGTTCTTCATT TGTCCCTTGTTCAAGCTGTGAGTGACACCTGTTACACATCATAGCAAGTATAT

ACCTGGGCCTTAGGAAACTTCACCTTAGTTTTCTAAGGCTCAACCTTCAACAGTCAGGAAAGTCAGCAACTGGAGTTCAAAGGAATGCAGTGACCTTCAT

CAGAACCCCAAACTGGACAACACCATCTTGTCAATATGGCTTAATATTAATATGGCTGTAACACAGGGCCAGTCCCTGTTTCCTTTATTAACCATGTGAG

CTGATTACAGTTTTTTTAAAGTCTAGACTAGTTTTCCATATGTTTTACACATTTTATTCTGACATCTTTAAAAACAAAGGACGCACACATTTGCATTTAT

CAATGCCCTTTTCTTTAAACTCGGGTTGACGTCCATCCTCTAGGATCTGCTTTCCATATTGTCTGTTTGCTGGGAGGCATCAGAGGTGCTGTCTTCACCT

GGCACTGTTGGCTGGGCTGACTCTCCAGTTAGCTGCATAATTTCTTCTATGACATTTGTAACAGACACAACATATACAAGACGACTGCAGTTTGTTGTTT

TCCTTGGCTGTTTTTTTCTTTTTTAAATATGTTTCCGGGTTCTCATATTTTCTTTTTCTTTGAATATATTGCACAACATGTTATTATTAGAAAAGGCTTT

ATGTCTCAGGCAAAAAGTTTTTCTCCACCCACAAGGTACTAATGTGTGTTGTTCTCTAAAAGAGGTAAGTGGTTGTCTGTGTGGCCATCCGCAAAGGGGA

CCTGAGAGGGGAAGGAAGGCAAGACGAGAGTGTTAGTTCCACTCTACAGGATGTCTCTAATCACAGGCTTTATAAGGGGCAATCCTTTCTATTTAGACAT

AACACCACCACCAGCACTTAAGACAAGCACCACCTGCAGTACCACTTACAGAACGGACAGGCTTGTAGGATCCAAGTCTGAAACGACAGCAAATTATTTC

CACTATAAATTTTCCAATTCCATGTAACATGCCTGCAATAAATAAGTTCAAGTTTTTCATTAAGTTGCCTTTGAAATTGCTATGTGAGAATCAAAAGCTG

TACCAACTGTAGAGGGTTAGACCACAAAAGGAATGAAGCCAAGCCGTCTGTGGCTGCCTCTGAGGCTCAAGGTACTCTCAAGGGTTACATTTAAAAACAA

ACATTTCATCAAGATCATAATCCACACACACAATACACACCTGATATAACCTACCCAAGACTTTCTTACATAATTTTGTAAGTAACAGATTTAAATGAAA

AAAGCAAAAGAACTGTGTAAGGACAGCTGCTCATTTGTACCAGAGATATGAATGAAAACAAGGTGGGGCTCCAAAAACACAACTATCTAGCTTGGAGTAA

CCAATGGCTCAAGATGAAGCTCCCAAAAAAATTCCAGAATCTTGAACAAAAACCAAAAGCATTACTGATTAAATCAAACCACCACCATCATGACTTCATA

GTGTACAGGGAAAAAAATTTCAATACATCTGTGATGCTTCCTGGGCATTTTCTTGTTTAACTCTACAATACACTTACAAACCAGATAATTACAATTCATA

AAAGGTAAGTGAACTATCTAAGGACTACCAAGTCAGTAGTGGAACACAGATTCTGTTCTAGCTCTGTCTGTAATTAATACACAGGATGTATGTGGCTTAC

CAATAATCTTCCTTACGTTACTGATTCCTGTGAATTGGATGTGCTTACAGGATATGAAATATATTTTAGAGCTTTAGAATTCAAAGAAGTTCCAAATATT

AAAACATGAAAATGTGACTATT
Translation
 - UNI36581 - MSMIAAFYSNKSILITGATGFLGKVLMEKLFRTSPHLKVIYILVRPKSGQTLQERVFQILNSK LFEKVKEVCPNVHEKIRPISAD

LNQRDFAISKEDVQELLSCTNIIFHCAATVRFDAHLR REAVQLNVTATQQLLLMASQMPKLEAFIHISTAFSNCNLSHIDEVIYPCPVEPRKIIDSME 

EWLDDSIIEEITPKLIGDRPNTYTYTKALGEIVVQQESGNLNVAIVRPSIVGATWQEPFP GWVDNLNGPSGLIIA TGKGFLRSIKATPMAVADVIPVD

TVVNLTIAVGWYTAVHR RPKSTLIYHSTSGNLNPCNWYKMG GLQVLATIEKIPFESAFRRPNADFTTSNFTTHYWNTVSHRVPAIIYDFYLRLTGRKP

R RMLKLMNRLLKTISMLEYFINHSWEWSTNNTEMLLSELSPEDQR VFNFDVRQLNWLEYIENYVLGVKKYLLKEDLAGIPKAKQHLRR RLRNIHYLF

NTALFLIIWRLLIARSQMARNVWFFI CPLFKL
Transcript ENSMUST00000032443
Sequence
GGCCTGTGCGTCCGAGGCCCCGGCACTCCTCCCGCCCTGGCAGAGGCCTCGGCTGGGCGCCCAGCAGCGACCAGGAAGGTCGGAGGGAGGGTGCGCTCCT

CCCGCCCCACACCCAGTTTCTGAGCCGGATATATAGAGAGTCACGTTTGGGAGCCGGGAGAGCAGAGGCGCGGTTCAGAAAAGCTCGAGTGCCTCCTTCA

TCTCCGGGAGGACCGTGACCACCAGCCGGCAAGTCAACCGCACTGAAGCAGCAG - UNI36581 - GACTCTCTTCCCAGAACCATACAGGAACGGAG

GAATCATGTCCATGATCGCAGCTTTCTACAGCAACAAGTCTATCCTCATCACAGGGGCCACAGGCTTCCTGGGCAAGGTGCTCATGGAGAAGTTATTCCG

TACCAGCCCCCACTTGAAAGTCATTTACATCCTCGTGAGACCCAAGTCTGGACAGACACTGCAGGAAAGGGTTTTCCAGATCCTCAACAGTAAG CTGTT

TGAGAAAGTCAAAGAAGTCTGTCCAAATGTGCATGAGAAGATCAGACCCATCTCCGCAGACCTCAACCAGCGTGACTTCGCCATCAGCAAGGAAGACGTG

CAAGAACTTCTGTCCTGTACCAATATTATCTTCCACTGTGCAGCCACAGTGCGCTTTGATGCACATCTGAG AGAAGCTGTGCAGCTGAACGTCACGGCC

ACCCAGCAGCTCCTGCTAATGGCCAGCCAGATGCCAAAGCTGGAAGCCTTCATCCACATCTCCACTGCCTTTTCCAACTGCAACCTGAGCCACATTGATG

AGGTCATCTACCCATGCCCTGTGGAGCCAAGAAAGATCATTGACTCCATGGA GTGGTTAGATGACTCTATCATTGAAGAGATCACTCCTAAGCTGATTG

GGGACCGGCCCAATACCTACACCTACACCAAAGCCTTGGGAGAGATAGTAGTGCAGCAAGAGAGCGGAAACCTGAATGTGGCCATTGTCAGGCCATCCAT

AGTGGGAGCAACCTGGCAGGAGCCTTTCCCG GGTTGGGTTGATAATCTAAATGGACCCAGCGGACTCATTATTGCG ACTGGGAAAGGATTTCTTCGGT

CCATAAAAGCGACTCCCATGGCAGTGGCAGATGTGATTCCAGTTGACACAGTTGTTAATCTCACCATAGCAGTAGGATGGTATACTGCAGTTCATAG GC

CTAAATCAACATTAATCTACCATTCCACATCTGGTAATCTCAATCCCTGTAACTGGTATAAAATGG GATTACAGGTCTTGGCGACCATCGAAAAGATCC

CATTTGAGAGTGCTTTCAGAAGGCCAAATGCTGACTTCACCACCAGCAATTTCACCACCCATTATTGGAACACCGTCAGCCACCGGGTCCCAGCCATCAT

CTATGACTTCTATCTGAGGCTTACTGGAAGGAAACCCAG AATGCTGAAGCTCATGAACCGGCTGCTAAAAACCATTTCCATGCTGGAGTATTTCATCAA

CCACAGTTGGGAATGGAGCACAAACAACACGGAGATGCTTCTGTCAGAGCTCAGTCCTGAAGACCAGAGA GTATTCAACTTTGATGTGCGTCAGTTGAA

CTGGCTCGAATACATTGAAAATTACGTTTTGGGGGTTAAGAAGTATCTACTAAAAGAGGATCTGGCCGGTATCCCCAAAGCAAAGCAACACCTAAGAAG 

GCTCCGGAACATTCACTACCTCTTTAACACTGCCCTGTTTCTTATCATCTGGCGCCTCCTCATTGCAAGGTCTCAGATGGCTCGGAACGTCTGGTTCTTC

ATTGTAAGCTTCTGTTACAAGTTCATCTCCTACTTTCGGGCCTCCAGCACACTCAAGGTCTAAGAACATTATACCAGCCCATCATCTGGAACCTCAGATA

CCTCTAAGGCAGTAAACTGGGTCTTAAGCTAGAAAGTAACAAGAAGCACTCCCAAGCTTCCAGTCAAAGTTGCCATTCCACCTTCTTCCCTATTCTTTGT

GTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGCGCGTGCGCGCGTGCGCATGCGTGTAGGATTGCTTGTTTGGTGTTTTGTTTTTGTTTTAGTGA

GGAAAGTCCATCTCTAACTGCATACATTTACAGAAACGTAACTTCCAGATTATATCCTGACACCACCACTCCACACTATCACACAGGAAGCATGAAAGCA

CTCCTTTTCCTTTATTTAGCTACTTCCCGACAAAACTAATTTAAACTCACTAAAGATGGAAGAACACGTGGCAGAAGTCTAAATAGGCTAGAGAAAGGCA

GCACCAAGCAGGGAAGCATGCTCAGTACCAAGGCAAGAGCTTCCAACCATTGTGAACTGCGCAGCTCAACCTCCTCACAATACAACACAAGTAGCCTTCT

GTGTTAAACACTACAGTCCTGGTTGAATTGAGGGGAAGTAGGCTCATGCCTATCCTGTTTCTCACCTCTGTCCCCAGCTTAATGCTAAAAGGAACAAACG

GTGTAGATGAGTACACACCAAATGAGAACACAATCATACATGCACCAGGGAGTCTTGTGTACTTCACTTATAACATGATTTGGACATCCCTTACTCTGCG

TTTTTCATCACCATTGTTCTGAAAGCTTCAAGTCCTCTTCTTACTTAATGACGTTGCCAAAGCCCTTCTACTTAAGTGTTTCACTCAGGCCTCAGTCAGA

AAGGATGATGGGGAGGGTGACGTTCCTAGACTCGAACCATGAAAACCCTCCTGACCTTTACCAGTGAGGGAAGCAAAACTTCAAATAAAATGTAAAGTTT

TAGTTTCTGTCTTCATGTGTGGAGTTGGGAGGAGCACATTCCTGGTCACCCAAGGCCCTTGTACCTCAGTTAACCCAGTCACACACCTTAGTTAACTCTA

TAATGTACAGTGGTCAAAACAACAAAGAGTAAAGCCTTTGGCTTAAGCATTTTAAATACAAATAGAAACCTTTAAACAGTCACAAATTCTCATACCCATA

AGATGGCACTCAGTTTTGCTCATATTTGAGATGAGGGCATCCTGGACTGCAGGATCTCTGCATGGTAACAATGAAATAGTCAAATAAAAGTAAAGTCCAC

ACAAATCACTGAAAATTGCACACAAGCAGCTAACATGTGTATGCTTACATTCTGATGGCTGAAGTGTGGCCATTACGGAGGTCTCCTCAGAACCATGAAG

AATATGTTGGGAAAACCCTTTCTGGCAGTTTCTGCAAATTTGATTAAGGTCAGTGACTACTGTCCAGGCAGAAAACTCAACTCTGAAATAAAGTACCTGT

GGGTTTCCCTATGTGAGACATCTGCAAGACTTGTGAGTTACATGAAAGACACCAGCTAAGGATACAGTAATAGGAACTCAACAGGCAGGAAGAGACTAAC

AGGACAGTTCTAAAGATTTACTACCTTTTGATCATTGTATCATCAATCCAAGATCTCCAGCGACTGAGTTTGAACTTCAGATTAAATAAAACTCTGAATT

ACTA
Translation
 - UNI36581 - MSMIAAFYSNKSILITGATGFLGKVLMEKLFRTSPHLKVIYILVRPKSGQTLQERVFQILNSK LFEKVKEVCPNVHEKIRPISAD

LNQRDFAISKEDVQELLSCTNIIFHCAATVRFDAHLR REAVQLNVTATQQLLLMASQMPKLEAFIHISTAFSNCNLSHIDEVIYPCPVEPRKIIDSME 

EWLDDSIIEEITPKLIGDRPNTYTYTKALGEIVVQQESGNLNVAIVRPSIVGATWQEPFP GWVDNLNGPSGLIIA TGKGFLRSIKATPMAVADVIPVD

TVVNLTIAVGWYTAVHR RPKSTLIYHSTSGNLNPCNWYKMG GLQVLATIEKIPFESAFRRPNADFTTSNFTTHYWNTVSHRVPAIIYDFYLRLTGRKP

R RMLKLMNRLLKTISMLEYFINHSWEWSTNNTEMLLSELSPEDQR VFNFDVRQLNWLEYIENYVLGVKKYLLKEDLAGIPKAKQHLRR RLRNIHYLF

NTALFLIIWRLLIARSQMARNVWFFIVSFCYKFISYFRASSTLKV

For any suggestions or comments, please send an email to unitrap@crg.es