Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030306 (Tmtc1)
Chromosomal location
Chr 6: 148185119 - 148392845 (-)
Description
transmembrane and tetratricopeptide repeat containing 1 Gene [Source:MGI (curated);Acc:Tmtc1-003]
RefSeq_peptide
NP_945318.2 
UniGene
Mm.137858 
MGI
MGI:3039590 
Uniprot/SWISSPROT
Q3UV71 
Uniprot/SPTREMBL
B2KG33 B2KG32 
Human Ortholog
ENSG00000133687 (TMTC1)
Omim not available
UniTrap UNI17818
Vector Insertion
Chr 6: 148243205 - 148254519
Public Clones IST10226F1 (tigm) IST12090D4 (tigm) IST12288A10 (tigm) IST11517A1 (tigm)
IST12803G10 (tigm) IST12415B10 (tigm) IST10206F2 (tigm) IST14118C6 (tigm)
Private Clones OST435961 (lexicon) OST434921 (lexicon)
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21552
Vector Insertion
Chr 6: 148233493 - 148243036
Public Clones not available
Private Clones OST326201 (lexicon)
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000060095
Sequence
AGAGCACCGGGCGCCCGGGCGGGGACAGTGGGCGTGCGATGCCTGAGCCAAGCAGGCCGCTGCGCGCCCGGGTCCCGGCCGGGGAGGATGCGCGCTGCGC

GGGAGCGGCCGTGCGGGCGGTGCGATGCTGGTGACCCGCGGGGACCGCGGCGGCGGGGAGCGCGCGCCCTCGCGGCGCCCGCGCTGCGGGCTGGTTCCAG

CGGGGGCCGCGGCGCTGCTAGCTGGGGCCAGCTGCCTTTGCTACGGCCGCTCGCTGCGGGGCGAGTTTGTACACGACGATGTGTGGGCGATCGTGAACAA

CCCCGACGTGCGGCCCGGGACACCGCTGCGCTGGGCCATCTTCGCTAACGACTTCTGGGGCAAGGGCCTGGCGGACAGCACCAGCCACAAGTCCTATCGG

CCACTGTGCGTGCTGTCCTTCAG GCTAAACATATTTCTGACTGGCATGAACCCTTTCTACTTCCACGCGGTCAATGTCATTCTACACTGCCTGGTGACC

CTTGTGCTGATGTATACCTGTGATAAAACAGTCTTCAAGAATCGCGGACTGGCGTTTGTCACAGCTTTGCTCTTTGCGGTGCACCCAGTCCACACTGAGG

CG GTGGCTGGCATCGTGGGCAGAGCTGATGTACTAGCATGCCTCCTGTTCCTGCTGGCCTTTCTTTCCTACCAAAG GAGTCTGGATCAGGGCTGTGCA

GGGCAGTGCTTCCCCACAACGGCTTCCCCCTTCTTCCTGCTGCTCAGTTTGTTTCTGGGGACCTGTGCCATGCTGGTGAAGGAGACAGGCATCACCGTGT

TTGGAGTGTGCTTGGTTTATGATCTCTTCTCTCCCTCCCACAAGCAGGACAAGTT GAGCAATGGGGCGGTCTGTCAGCACAGCTCTGGGCAGCCAGGGA

GCCCCCAGCCTTCCTCTCAGCAAGCCCACCCCCACCGTGAGAGCAGAAAGCAGCGCTTCCCACACAAAGACTCCTGGGGAGGCTGCCATTCACCATTGCC

ACCAGAGCCCAAGAGCAGTGGATTCCCCATGTCGCCGAGAGCTATGTGGTCTCTGATGAG GTGTCTGACTGGGAGCACCAACAGAAATTTCCTTCTTAC

CTTGAGACCGTTTTTAAAGCGGGCCATTTTGGTCATCAGTTAT GTGACTGTCATTTTGTATTTCCGCCTGTGGATAATGGGAGGAACTATGCCCCTCTT

CTCAGAGCAAGACAATCCAGCTTCATTCTCGCCATACATCCTTACAAG GTTCCTTACCTATTCCTACCTCCTGGCCTTCAATGTATGGCTTCTGCTGGC

ACCCATCACTCTGTGCTACGACTGGCAAGTGGGAAGTATCCCTCTGGTGGAGACCATATGGGATGTGAGGAACCTTGCTACCATCCTTCTGGCAGTGGTG

ATGGCCTTACTGAGCCTGCACTGTGTGGCAGCCTTCAAG AGGCTGGAGCACAAGGAAGTATTGGCCGGCTTGCTGTTCCTCGTGTTCCCGTTCATTCCA

GCCAGCAACCTATTCTTCAGGGTGGGCTTTGTGGTGGCCGAGAGAGTCCTGTACATGCCTAG - UNI17818 - CATGGGCTACTGCATTCTGTTTGT

GCATGGACTGAGTAAGCTCTGTGCTGGGCTGAGCCGGTGCGGGGCCACCTCCCTGATGGCGTCCACTGTGTTGCTTCTGCTGCTGTTCTCCTGGAAGACT

GTGAAGCAGAATGAAATCTGGCTGTCGAGAGAGTCCTTATTCAG - UNI21552 - GTCTGGAGTTCAGACTCTACCCCACAATGCCAAGGTTCATTA

CAACTACGCCAATTTCCTAAAAGACCAAGGTCGGAACAAGGAAGCGATCTACCACTACAGAACCGCCCTCAA GCTGTACCCACGCCACGCAAGTGCACT

GAACAACCTTGGGACACTGACCAAGGACATGGCAGAAGCTAAGATGTACTACCAGAAGGCATTGCAGCTCCACCCGCAGCACAACCGTGCACTTTTCAAT

CTGGGGAATCTCCTCAA GTCCCAGGAGAAGACAGAAGAAGCCATCATGCTGCTGAAGGAATCCATTAAATATGGTCCAGATTTTGCTGATGCCTATTCA

AGCTTGGCTTCCCTACTGGCGGAGCAG GAAAGATTTAAGGAAGCTGAGGACATTTACCAGGCTGGAATAAAGAACTGTCCGGACAGCTCAGACTTACAC

AACAACTATGCAGTTTTCTTAGTTGACTCTG GCTTTCCTGAGAAGGCTGTGGCTCACTACCAGCAGGCCATCCAGCTCAGCCCAAGCCATCATGTGGCT

GTGGTGAACCTAGGCCGACTCTACAGGTCCCTGGGAGAGAACAGCAAGGCTGAAGAGTGGTACAGACG TGCCCTGAAGGTGGCCCGCACGGCTGAGGTA

CTGTCACCTCTGGGAGCGCTCTATTACAACACTGGCCGACACAAGGAGGCACTGGAGGTGTACAGGGAAGCTGTCTCACTCCAGCCTTCCCAGAGGGAGC

TCCGCCTGGCTCTG GCACAGGTTTTAGCAGTGATGGGTCAGACCAAAGAAGCTGAAAAGATAACCAGCCATATAGTCTCTGAGGAGCCCAGGTGCCTGG

AGTGCTACCGCCTCCTGTCAGCAATCCACAGCAAGCAGGAGCACCATGGGAAG GCACTCGAGGCCATAGAGAAGGCTCTTCAACTGAAGCCCAAGGACC

CAAAAGTCATATCTGAACTATTCTTTACAAAAGGAAACCAGCTAAGAGAACAGAACCTTCTGGACAAAGCTTTTGAG AGCTATGAAGCTGCTGTGACCC

TGGATCCTGACCAGGCACAGGCATGGATGAACATGGGTGGCATCCGGCACATCCAG GGAAGCTATGTGTCTGCAAGGGCCTATTATGAGAGAGCCCTGA

AGCTGGTTCCAGACAGCAAGCTGCTGAAGGAAAATCTGGCCAAGCTGGATCGCCTGGAGAGGAGGTTACAAGAAGTCAGAGAACGGGATCAAACATAGAT

CAAAAAAGGACACATTCACGTGGGACTCACCGGCCTGAAGAGGACAGAGTTGGGGAGGCCTTGCTTATACACAGCAGGCTCTGCCAGCCAGGCAGTCCTC

TCCTGGTGACACAGTGGGAGTCAGTCACTGATGACTGTGTTGAAAGAGTTGTTTCCATGAAGAGACAAACAGCAGAGGAGAGCACACTGTCTGCAGGGAA

GGGAGATAGCAAGTGCACGCTTTGCCAGCTCCTGTGTGACCCCCAGTCCCAGGATATTAAGCAGTGCTTTGGCAGCAGATAGTGACCTTCATTATTACTA

TAGCCCAGAAATACAGAAACTCAAAGTCCTGTAAACACAGCAGCTGTTCCTAAGAAAGGATGTGTTCTCTGAAGTCAGCCCTTGAAAATCCGCTTGTGCA

ACTTCAGTTAATTCTCAACAATCTAGAGTCGGTGGTGAAGAGCATTGGTAGAGCCCTGTGGAGGCAGGGGAGCAGAGCACTTGATAGCTGGGCTTGGGCT

AGCATCGCCCAGATTATCACTAAGCACTTTTGGAGAAGTACATTAAATGCTACTCTGGTATATGTTTTTTTCTAGTGCCTAAAACACCAAGATGGAATCT

TCTAGAATTGTATGTGACTATATGTATCTCTACAGGAAAGTCGAAGCTCAGCACCCTTGATTCTTTATGGAAGTGTTTTAAATGTTTGAACTGTATTCCA

GGTTTCACTAGTGTTGTGTCTCCACTCTGAGCCTTCTGAGTGCATTAACACTGAGGTTGGGACCCTGAAATGTGTTGCTCAGGTGTGGAGCTGTGGGCTG

CACTCCTCACAGAAGTGTTAAAGGGTCTGTCCAGGGAAGGGCTCTACTTTATTCTTTTAAGATCAAGACTTATGAGATTTATTGTTTTTGAAAGATATAT

TTGAGCACTAAAGAATCTTTACATTGTGTTACAGAATTCCTCATAGACTCTTAAGTTGAGGGAAAAGAGCTCTGTCATTGACTTTTGAGATTTACTGAGG

ATTCTGTATTTAAAACACAAGTGAGTTTGGAGACTTTGTAGAGAATACTCTAAAACTCTAGGATGAAGTCAAAATTCATAATTTTTTAAAAATATATTTA

TATTTAAAAACAAGGAAGACAAAGTTGAAATCACAATTTGACATTATTTTTAGTGTTATTTATTGTATAACTTATAAAATATTTAATATATATCC
Translation
MLVTRGDRGGGERAPSRRPRCGLVPAGAAALLAGASCLCYGRSLRGEFVHDDVWAIVNNPDVRPGTPLRWAIFANDFWGKGLADSTSHKSYRPLCVLSFR

 RLNIFLTGMNPFYFHAVNVILHCLVTLVLMYTCDKTVFKNRGLAFVTALLFAVHPVHTEA VAGIVGRADVLACLLFLLAFLSYQR RSLDQGCAGQCF

PTTASPFFLLLSLFLGTCAMLVKETGITVFGVCLVYDLFSPSHKQDKL LSNGAVCQHSSGQPGSPQPSSQQAHPHRESRKQRFPHKDSWGGCHSPLPPE

PKSSGFPMSPRAMWSLMR RCLTGSTNRNFLLTLRPFLKRAILVISY VTVILYFRLWIMGGTMPLFSEQDNPASFSPYILTR RFLTYSYLLAFNVWLL

LAPITLCYDWQVGSIPLVETIWDVRNLATILLAVVMALLSLHCVAAFK RLEHKEVLAGLLFLVFPFIPASNLFFRVGFVVAERVLYMPS - UNI1781

8 - SMGYCILFVHGLSKLCAGLSRCGATSLMASTVLLLLLFSWKTVKQNEIWLSRESLFR - UNI21552 - RSGVQTLPHNAKVHYNYANFLKDQG

RNKEAIYHYRTALK KLYPRHASALNNLGTLTKDMAEAKMYYQKALQLHPQHNRALFNLGNLLK KSQEKTEEAIMLLKESIKYGPDFADAYSSLASLLA

EQ ERFKEAEDIYQAGIKNCPDSSDLHNNYAVFLVDSG GFPEKAVAHYQQAIQLSPSHHVAVVNLGRLYRSLGENSKAEEWYRR RALKVARTAEVLSP

LGALYYNTGRHKEALEVYREAVSLQPSQRELRLAL AQVLAVMGQTKEAEKITSHIVSEEPRCLECYRLLSAIHSKQEHHGK ALEAIEKALQLKPKDPK

VISELFFTKGNQLREQNLLDKAFE SYEAAVTLDPDQAQAWMNMGGIRHIQ GSYVSARAYYERALKLVPDSKLLKENLAKLDRLERRLQEVRERDQT
Transcript ENSMUST00000100772
Sequence
AGAGCACCGGGCGCCCGGGCGGGGACAGTGGGCGTGCGATGCCTGAGCCAAGCAGGCCGCTGCGCGCCCGGGTCCCGGCCGGGGAGGATGCGCGCTGCGC

GGGAGCGGCCGTGCGGGCGGTGCGATGCTGGTGACCCGCGGGGACCGCGGCGGCGGGGAGCGCGCGCCCTCGCGGCGCCCGCGCTGCGGGCTGGTTCCAG

CGGGGGCCGCGGCGCTGCTAGCTGGGGCCAGCTGCCTTTGCTACGGCCGCTCGCTGCGGGGCGAGTTTGTACACGACGATGTGTGGGCGATCGTGAACAA

CCCCGACGTGCGGCCCGGGACACCGCTGCGCTGGGCCATCTTCGCTAACGACTTCTGGGGCAAGGGCCTGGCGGACAGCACCAGCCACAAGTCCTATCGG

CCACTGTGCGTGCTGTCCTTCAG GCTAAACATATTTCTGACTGGCATGAACCCTTTCTACTTCCACGCGGTCAATGTCATTCTACACTGCCTGGTGACC

CTTGTGCTGATGTATACCTGTGATAAAACAGTCTTCAAGAATCGCGGACTGGCGTTTGTCACAGCTTTGCTCTTTGCGGTGCACCCAGTCCACACTGAGG

CG GTGGCTGGCATCGTGGGCAGAGCTGATGTACTAGCATGCCTCCTGTTCCTGCTGGCCTTTCTTTCCTACCAAAG GAGTCTGGATCAGGGCTGTGCA

GGGCAGTGCTTCCCCACAACGGCTTCCCCCTTCTTCCTGCTGCTCAGTTTGTTTCTGGGGACCTGTGCCATGCTGGTGAAGGAGACAGGCATCACCGTGT

TTGGAGTGTGCTTGGTTTATGATCTCTTCTCTCCCTCCCACAAGCAGGACAAGTT GAGCAATGGGGCGGTCTGTCAGCACAGCTCTGGGCAGCCAGGGA

GCCCCCAGCCTTCCTCTCAGCAAGCCCACCCCCACCGTGAGAGCAGAAAGCAGCGCTTCCCACACAAAGACTCCTGGGGAGGCTGCCATTCACCATTGCC

ACCAGAGCCCAAGAGCAGTGGATTCCCCATGTCGCCGAGAGCTATGTGGTCTCTGATGAG GTGTCTGACTGGGAGCACCAACAGAAATTTCCTTCTTAC

CTTGAGACCGTTTTTAAAGCGGGCCATTTTGGTCATCAGTTAT GTGACTGTCATTTTGTATTTCCGCCTGTGGATAATGGGAGGAACTATGCCCCTCTT

CTCAGAGCAAGACAATCCAGCTTCATTCTCGCCATACATCCTTACAAG GTTCCTTACCTATTCCTACCTCCTGGCCTTCAATGTATGGCTTCTGCTGGC

ACCCATCACTCTGTGCTACGACTGGCAAGTGGGAAGTATCCCTCTGGTGGAGACCATATGGGATGTGAGGAACCTTGCTACCATCCTTCTGGCAGTGGTG

ATGGCCTTACTGAGCCTGCACTGTGTGGCAGCCTTCAAG AGGCTGGAGCACAAGGAAGTATTGGCCGGCTTGCTGTTCCTCGTGTTCCCGTTCATTCCA

GCCAGCAACCTATTCTTCAGGGTGGGCTTTGTGGTGGCCGAGAGAGTCCTGTACATGCCTAG - UNI17818 - CATGGGCTACTGCATTCTGTTTGT

GCATGGACTGAGTAAGCTCTGTGCTGGGCTGAGCCGGTGCGGGGCCACCTCCCTGATGGCGTCCACTGTGTTGCTTCTGCTGCTGTTCTCCTGGAAGACT

GTGAAGCAGAATGAAATCTGGCTGTCGAGAGAGTCCTTATTCAG - UNI21552 - GCTGTACCCACGCCACGCAAGTGCACTGAACAACCTTGGGAC

ACTGACCAAGGACATGGCAGAAGCTAAGATGTACTACCAGAAGGCATTGCAGCTCCACCCGCAGCACAACCGTGCACTTTTCAATCTGGGGAATCTCCTC

AA GTCCCAGGAGAAGACAGAAGAAGCCATCATGCTGCTGAAGGAATCCATTAAATATGGTCCAGATTTTGCTGATGCCTATTCAAGCTTGGCTTCCCTA

CTGGCGGAGCAG GAAAGATTTAAGGAAGCTGAGGACATTTACCAGGCTGGAATAAAGAACTGTCCGGACAGCTCAGACTTACACAACAACTATGCAGTT

TTCTTAGTTGACTCTG GCTTTCCTGAGAAGGCTGTGGCTCACTACCAGCAGGCCATCCAGCTCAGCCCAAGCCATCATGTGGCTGTGGTGAACCTAGGC

CGACTCTACAGGTCCCTGGGAGAGAACAGCAAGGCTGAAGAGTGGTACAGACG TGCCCTGAAGGTGGCCCGCACGGCTGAGGTACTGTCACCTCTGGGA

GCGCTCTATTACAACACTGGCCGACACAAGGAGGCACTGGAGGTGTACAGGGAAGCTGTCTCACTCCAGCCTTCCCAGAGGGAGCTCCGCCTGGCTCTG 

GCACAGGTTTTAGCAGTGATGGGTCAGACCAAAGAAGCTGAAAAGATAACCAGCCATATAGTCTCTGAGGAGCCCAGGTGCCTGGAGTGCTACCGCCTCC

TGTCAGCAATCCACAGCAAGCAGGAGCACCATGGGAAG GCACTCGAGGCCATAGAGAAGGCTCTTCAACTGAAGCCCAAGGACCCAAAAGTCATATCTG

AACTATTCTTTACAAAAGGAAACCAGCTAAGAGAACAGAACCTTCTGGACAAAGCTTTTGAG AGCTATGAAGCTGCTGTGACCCTGGATCCTGACCAGG

CACAGGCATGGATGAACATGGGTGGCATCCGGCACATCCAG GGAAGCTATGTGTCTGCAAGGGCCTATTATGAGAGAGCCCTGAAGCTGGTTCCAGACA

GCAAGCTGCTGAAGGAAAATCTGGCCAAGCTGGATCGCCTGGAGAGGAGGTTACAAGAAGTCAGAGAACGGGATCAAACATAGATCAAAAAAGGACACAT

TCACGTGGGACTCACCGGCCTGAAGAGGACAGAGTTGGGGAGGCCTTGCTTATACACAGCAGGCTCTGCCAGCCAGGCAGTCCTCTCCTGGTGACACAGT

GGGAGTCAGTCACTGATGACTGTGTTGAAAGAGTTGTTTCCATGAAGAGACAAACAGCAGAGGAGAGCACACTGTCTGCAGGGAAGGGAGATAGCAAGTG

CACGCTTTGCCAGCTCCTGTGTGACCCCCAGTCCCAGGATATTAAGCAGTGCTTTGGCAGCAGATAGTGACCTTCATTATTACTATAGCCCAGAAATACA

GAAACTCAAAGTCCTGTAAACACAGCAGCTGTTCCTAAGAAAGGATGTGTTCTCTGAAGTCAGCCCTTGAAAATCCGCTTGTGCAACTTCAGTTAATTCT

CAACAATCTAGAGTCGGTGGTGAAGAGCATTGGTAGAGCCCTGTGGAGGCAGGGGAGCAGAGCACTTGATAGCTGGGCTTGGGCTAGCATCGCCCAGATT

ATCACTAAGCACTTTTGGAGAAGTACATTAAATGCTACTCTGGTATATGTTTTTTTCTAGTGCCTAAAACACCAAGATGGAATCTTCTAGAATTGTATGT

GACTATATGTATCTCTACAGGAAAGTCGAAGCTCAGCACCCTTGATTCTTTATGGAAGTGTTTTAAATGTTTGAACTGTATTCCAGGTTTCACTAGTGTT

GTGTCTCCACTCTGAGCCTTCTGAGTGCATTAACACTGAGGTTGGGACCCTGAAATGTGTTGCTCAGGTGTGGAGCTGTGGGCTGCACTCCTCACAGAAG

TGTTAAAGGGTCTGTCCAGGGAAGGGCTCTACTTTATTCTTTTAAGATCAAGACTTATGAGATTTATTGTTTTTGAAAGATATATTTGAGCACTAAAGAA

TCTTTACATTGTGTTACAGAATTCCTCATAGACTCTTAAGTTGAGGGAAAAGAGCTCTGTCATTGACTTTTGAGATTTACTGAGGATTCTGTATTTAAAA

CACAAGTGAGTTTGGAGACTTTGTAGAGAATACTCTAAAACTCTAGGATGAAGTCAAAATTCATAATTTTTTAAAAATATATTTATATTTAAAAACAAGG

AAGACAAAGTTGAAATCACAATTTGACATTATTTTTAGTGTTATTTATTGTATAACTTATAAAATATTTAATATATATCC
Translation
MLVTRGDRGGGERAPSRRPRCGLVPAGAAALLAGASCLCYGRSLRGEFVHDDVWAIVNNPDVRPGTPLRWAIFANDFWGKGLADSTSHKSYRPLCVLSFR

 RLNIFLTGMNPFYFHAVNVILHCLVTLVLMYTCDKTVFKNRGLAFVTALLFAVHPVHTEA VAGIVGRADVLACLLFLLAFLSYQR RSLDQGCAGQCF

PTTASPFFLLLSLFLGTCAMLVKETGITVFGVCLVYDLFSPSHKQDKL LSNGAVCQHSSGQPGSPQPSSQQAHPHRESRKQRFPHKDSWGGCHSPLPPE

PKSSGFPMSPRAMWSLMR RCLTGSTNRNFLLTLRPFLKRAILVISY VTVILYFRLWIMGGTMPLFSEQDNPASFSPYILTR RFLTYSYLLAFNVWLL

LAPITLCYDWQVGSIPLVETIWDVRNLATILLAVVMALLSLHCVAAFK RLEHKEVLAGLLFLVFPFIPASNLFFRVGFVVAERVLYMPS - UNI1781

8 - SMGYCILFVHGLSKLCAGLSRCGATSLMASTVLLLLLFSWKTVKQNEIWLSRESLFR - UNI21552 - RLYPRHASALNNLGTLTKDMAEAKM

YYQKALQLHPQHNRALFNLGNLLK KSQEKTEEAIMLLKESIKYGPDFADAYSSLASLLAEQ ERFKEAEDIYQAGIKNCPDSSDLHNNYAVFLVDSG G

FPEKAVAHYQQAIQLSPSHHVAVVNLGRLYRSLGENSKAEEWYRR RALKVARTAEVLSPLGALYYNTGRHKEALEVYREAVSLQPSQRELRLAL AQVL

AVMGQTKEAEKITSHIVSEEPRCLECYRLLSAIHSKQEHHGK ALEAIEKALQLKPKDPKVISELFFTKGNQLREQNLLDKAFE SYEAAVTLDPDQAQA

WMNMGGIRHIQ GSYVSARAYYERALKLVPDSKLLKENLAKLDRLERRLQEVRERDQT

For any suggestions or comments, please send an email to unitrap@crg.es