Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030307 (Slc6a11)
Chromosomal location
Chr 6: 114081235 - 114199880 (+)
Description
solute carrier family 6 (neurotransmitter transporter, GABA), member 11 Gene [Source:MGI Symbol;Acc:MGI:95630]
Human Ortholog
not available
Omim not available
UniTrap UNI35572
Vector Insertion
Chr 6: 114112168 - 114144604
Public Clones IST14404C3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000032451
Sequence
AGAGCCGGGGCCGGCGCACGAGGCGGCAGGGCGGCCATGACTGCGGAGCAAGCGCTGCCCCTGGGCAACGGGAAAGCGGCCGAGGAGGCGCGGGGGTCCG

AGACGCTGGGCGGCGGCGGCGGGGGCGCGGCGGGGACGCGCGAGGCGCGCGACAAGGCTGTCCACGAGCGCGGCCACTGGAACAACAAGGTGGAGTTCGT

GTTGAGCGTAGCTGGAGAGATCATCGGACTGGGCAACGTGTGGCGCTTTCCCTACCTGTGCTACAAAAACGGCGGAG GGGCATTCCTGATTCCTTACGT

GGTGTTTTTCATCTGCTGCGGAATCCCCGTCTTCTTCCTGGAAACGGCTCTGGGGCAGTTCACGAGCGAGGGTGGCATCACGTGCTGGAGGAGGGTCTGC

CCTTTATTTGAAG GCATTGGCTATGCAACACAGGTGATCGAGGCACACCTCAATGTCTACTACATCATCATCCTGGCGTGGGCCATCTTCTACCTAAGC

AATTGCTTCACCACCGAGCTCCCCTGGGCCACCTGTGGGCACGAGTGGAACACAG AGAAATGTGTGGAGTTCCAGAAGCTGAACTTCAGCAACTACAGT

CATGTGTCCCTGCAGAATGCCACCTCCCCGGTCATGGAGTTCTGGGA ACGCCGGGTCTTGGCTATATCCGATGGCATTGAGCACATTGGGAACCTCCGT

TGGGAACTGGCATTATGTCTCCTGGCGGCCTGGACCATCTGCTACTTCTGCATATGGAAGGGTACTAAGTCGACTGGAAAG - UNI35572 - GTCGT

GTATGTCACTGCAACCTTCCCCTACATCATGCTGCTGATCCTCCTGATCCGAGGGGTCACGTTGCCAGGCGCCTCTGAAGGCATCAAGTTCTATCTGTAC

CCTGACCTCTCCCGGCTCTCTGACCCACAG GTGTGGGTGGACGCTGGGACGCAGATCTTTTTCTCCTATGCCATCTGCCTGGGCTGCCTAACCGCTCTG

GGGAGTTACAACAACTATAACAACAACTGCTACAG GGACTGCATTATGCTCTGCTGTCTAAACAGTGGCACCAGCTTCGTGGCTGGGTTTGCCATCTTC

TCAGTCCTGGGCTTCATGGCATACGAGCAGGGTGTGCCTATTGCCGAGGTGGCAGAGTCAG GTCCTGGACTGGCTTTCATCGCCTACCCCAAGGCTGTC

ACTATGATGCCCCTCTCTCCACTGTGGGCCACCTTGTTCTTCATGATGCTCATCTTCCTGGGCCTGGACAGTCAG TTTGTGTGCGTGGAGAGTCTTGTG

ACAGCCGTGGTAGACATGTACCCTAAGGTCTTCCGGCGGGGCTACCGGCGAGAACTGCTCATCCTGGCCCTGTCCATCATCTCCTATTTCCTAGGCCTGG

TGATGCTGACCGAG GGAGGCATGTACATCTTCCAGCTTTTTGACTCATACGCCGCCAGTGGCATGTGCTTGCTCTTTGTGGCCATCTTTGAGTGTGTCT

GCATCGGCTGGGTATATG GAAGCAACCGGTTCTATGACAATATTGAGGATATGATTGGTTACCGGCCACTGTCACTCATCAAGTGGTGCTGGAAAGTCG

TGACCCCTGGGATCTGTGCG GGCATCTTCATCTTCTTTCTGGTCAAGTACAAACCGCTCAAGTACAACAATGTGTACACATATCCTGCTTGGGGCTACG

GCATCGGCTGGCTCATGGCTCTGTCCTCCATGCTGTGTATCCCACTCTGGATCTTCATTAAGCTGTGGAAGACAGAGGGCACACTGCCCGAG AAATTAC

AGAAGTTGACAGTCCCCAGCGCCGATCTGAAAATGCGGGGCAAGCTTGGGGCCAGCCCACGGACGGTGACCGTTAATGACTGTGAGGCCAAGGTCAAGGG

CGACGGCACCATCTCTGCCATCACAGAGAAGGAGACACACTTCTGAGTCCCCACCAGCCATTTGGATGCGGCTCCAACCTTCCTTCCCTGCGTGTAAATG

AATCCTGAACCTCGTACTTCACCTAATGTTAGGGGCTTGCTCGTCTGCACAGGACTTATTAACAAGTTAACTCCCAGCCGGCCACTGTGTGCCCTGTACC

CTTGCCTCTTCCCAGTGATAGTGGGCATATCCACCTCACCAAGATAATTCTGTACAGTGACTAGCAGATCCTGGCCTAGGGTGGCTCAGCCGGTGTTTTC

TAGAGTCCTTGTATTATATACTGTCAACTCGTATGCTGGGGGCAGGTGGAGTGGGGGAGCGGTGCCCATCTGCCTCTGATGTTCAGTCATTCCTGGTTTT

ATCTCTGAACTTCCCTGGCCACCCTCCTCTGTGCCCTGGGACCAGTTTGTTTTATTTTATTTTTTTTTCTTTTGGTCTTCCCCTTTTCCTAGTGACACCT

TCCACATGTCAATGTCGTAAGACAGAGAGCAAAGCCTCCCACCATCGTTAGGACTCCTGAGTAACCAGGAGTTGCTGACTGTCCCTTCAAGTGACTGTGG

CTCCTTTCTCTCCCTGGCCCCTAGTTTCTCCATCTCCCAGACCAAGGGGGCGAGGGGGTTGAGTGGAGTCTTCCCTTCAAAGCAGGGAAGAATACCTGAC

TCGTTGCTTCGCAGAGCTGCTTTGACCTGCAGAGACTTGTAGACCTCTTCTCTTCTCTGTCCCCTTGGTTACCACCTACCCACCTTGCCTATTTTAAGTG

AAACTTACCACCAATGATGTGGGGAAGTGTGTTTCCCTAACAACTGGAGTTTTAGCCTAACCCTGATCCCTTAACTGGTGCACCCCAGCCCCCGTGTTCG

GGGCTCCCACCATCTGTCCAGCCTTCTTGGCCACCAGCTCTGTCCCTCCTTCCTAGATAGGGATGATCAGAAGGTAGCCATCTCTTCTTGCAGCTGCCTG

GCCAGGATCTATGGCTTAGGATCTATGGCCACCCCTGCAGGGGAGCTACAGTGAGGCCTGGGGCTGGATTCCACCCACAGTCCCTTCCCTGTGCACCCTG

CTTTGTCCCCTGCCTTGTCCCCTGCTCTCTCTTCTACCTACCTGCCTACCCCTGCAGATCCTGTGGGCAGACACCTTACTCTGGAGCCATTCCACCTGCC

TGTCACCTGGGTCTGAGAAGCCTTCACTTCCACTTGCCAGAGGGAAGAACTGGCCACCCATCTGTCAGGCTCTTCCTTGGAAACGAAGAGCAGAGGTGGT

CTCTAGGGGGAGGCTGGTGCCATTCCCTCCTGCCTGGCTCAGACCTCTTAGACTGGTCTCTCTTCCTCAGCTGCTGGGTTCTTTGTCTGCCCAGCTATTG

GAGGATGGGAAGTGGAGGGAGGGTCACTCTTTCCCTCTTACTGTAGTTTCCTAGATTTATCTGAGGAAAAGTGAGATGTCTTCACGCTAAGGCTCCAGTG

TTCTGTCAGAGACCTGAATGCTCTATTTGCCCAATGCTTCCAGACTCTTAGCTGTTCTGCCCAGCCCCCGTCCCGCTCCCACCTAAAGCCTGAGTTGGCT

GAGCCAAATGCCCAGCACTGCCCCCACCTAACTGGGCACTTGTCTAGGGCACACCACCCCCAGCTGCTCACACACAGACCACATATTCCTTCTGGGAAGG

CCAGCATCATCCTGAAGATGACCTGTGGGGTTGGTCCTTGATGGCTGTCCCCTCCACCCTACCCCTGAGAAGGGAAGCTGCCCGTTGCTGCTACTGCACC

TCACCACCAACTCCCTCATGGACAGACAGATCCCTGATGTCTGTCACTATAGACACACGTGTTGTACATGTGGCCCTTAACACTTGACACTCTTAACACT

ACTCATGGGGCTGGGTAGAGGGAGGCTTGTGGTTTGGGGGGTTGTTATTTTTTGCTTTCTTTTCTTCCTTTCTTTTTTCTTTTTGTCTTTTTTTGTAATT

TCATACTAGTATTTGGGTAACTGTAGGGAGGAGGGGAGGGTAAGTGGGGGCAAGTGGGGGCAAGGGGACATATCATTGTGACAACTTTTTTGATATTTAC

TAGAAATGATGCAATATATCCTTTCTGAGATATTTACAGTATTATTAAAGGGTTGGGCTGTTTTGCATAACAAACTTTTTATTGGCATACCC
Translation
MTAEQALPLGNGKAAEEARGSETLGGGGGGAAGTREARDKAVHERGHWNNKVEFVLSVAGEIIGLGNVWRFPYLCYKNGGG GAFLIPYVVFFICCGIPV

FFLETALGQFTSEGGITCWRRVCPLFEG GIGYATQVIEAHLNVYYIIILAWAIFYLSNCFTTELPWATCGHEWNTE EKCVEFQKLNFSNYSHVSLQNA

TSPVMEFWE ERRVLAISDGIEHIGNLRWELALCLLAAWTICYFCIWKGTKSTGK - UNI35572 - VVYVTATFPYIMLLILLIRGVTLPGASEGIK

FYLYPDLSRLSDPQ VWVDAGTQIFFSYAICLGCLTALGSYNNYNNNCYR RDCIMLCCLNSGTSFVAGFAIFSVLGFMAYEQGVPIAEVAESG GPGLA

FIAYPKAVTMMPLSPLWATLFFMMLIFLGLDSQ FVCVESLVTAVVDMYPKVFRRGYRRELLILALSIISYFLGLVMLTE GGMYIFQLFDSYAASGMCL

LFVAIFECVCIGWVYG GSNRFYDNIEDMIGYRPLSLIKWCWKVVTPGICA GIFIFFLVKYKPLKYNNVYTYPAWGYGIGWLMALSSMLCIPLWIFIKL

WKTEGTLPE KLQKLTVPSADLKMRGKLGASPRTVTVNDCEAKVKGDGTISAITEKETHF

For any suggestions or comments, please send an email to unitrap@crg.es