Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030309 (C1qdc1)
Chromosomal location
Chr 6: 148791015 - 148844759 (-)
Description
caprin family member 2 Gene [Source:MGI (curated);Acc:C1qdc1-001]
RefSeq_dna
NM_181541 
RefSeq_peptide
NP_853519.2 
UniGene
Mm.150568 
MGI
MGI:2448541 
Uniprot/SWISSPROT
Q05A80 
Uniprot/SPTREMBL
B2KGD5 Q0P6A6 B2KGD6 
Human Ortholog
ENSG00000110888 (CAPRIN2)
Omim not available
UniTrap UNI22243
Vector Insertion
Chr 6: 148843679 - 148844539
Public Clones not available
Private Clones OST302573 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36587
Vector Insertion
Chr 6: 148839130 - 148843679
Public Clones IST11844F5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8123
Vector Insertion
Chr 6: 148832057 - 148839130
Public Clones RRG205 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17795
Vector Insertion
Chr 6: 148826503 - 148831969
Public Clones not available
Private Clones OST436321 (lexicon) OST56086 (lexicon) OST42930 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5808
Vector Insertion
Chr 6: 148799966 - 148807122
Public Clones CSH802 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5864
Vector Insertion
Chr 6: 148796814 - 148799796
Public Clones CSH874 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111569
Sequence
GGGCGTGGTCGCGCCGTGCGCGGCCTACATAAGTTGCGCGCGCCTTGAGGGGGACAGCTTGGGCGCGAGCAGCGGAGTTGGCTGGGTGCACTGTCGGCGG

TGGCCGCAGGCTAAGCTGAGGCGGGAGGAAGGGACGCGGGGGGAGAAGGGAGTGCGGGGTGGAGTTCGCCCACTTTGCAGCGCGCAGGACTCCCGCGCGC

TTTCGGAGGCAGCCGGGGAG - UNI22243 - - UNI36587 - TCACCTTCAGGCCGGCCATTCAGAGGAGGGAAAAGTGGGAAGTATGAAGTCAG

CCAAGTCCCAAGTGAACCAGGATCAGCAAGGGGAAAACCAGCGGGCTCTGAGCCCCCTGCAGTCTACTCTCAGTTCTGCTGCATCTCCTTCCCAGGCATA

TGAAACCTATATTGATAATGGACTTATATGCCTTAAACACAAAATTAGGAACATCGAGAAGAAGAAG - UNI36587 - CTCAAACTGGAAGATTATA

AAGATCGCCTTAAAAATGGAGAGCAGCTTAACCCAGACCAGTTG - UNI8123 - - UNI36587 - GAAGCAGTAGAAAAGTATGAAGAAGTACTT

CATAATTTGGAATTTGCCAAGGAGCTTCAGAAAACTTTTTCTGCACTGAGCCAAGAT - UNI17795 - CTGCTGAAAGCGCAGAAAAAGGCCCAGAG

AAGGGAGCATATGCTGAAACTTGAGACTGAGAAGAAAAAGCTTCGAACTATGCTTCAAATTCAGTATGTATTACAGAATTTGACACAAGAACATGTACAA

AAAGACTTCAAAGGGGGCTTGAATGGTGCAATGTATTTGCCTTCAAAAGAACTTGACTACCTCATTAAATTCTCAAAACTGACCTGCCCTGAAAGAAATG

AAAGTCTGAG TGTTGAAGACCAGATGGAGCAGTCATCCTTGTACTTTTGGGACCTTTTGGAAGGTAGTGAAAAAACAGTGGTAGGAACAACAT ATAAA

CATGTGAAAGACCTGCTGTCTAAATTGCTGCACTCAGGTTATTTTGAAAGTGTCCCAGTTCTCAGGAATTCTAAGGAAAAAGCAGAAGAAGTGCTAATGC

AATCAGAAATGAAAAAACAGTTACTGAAGAGTGAGTCTATCAAAGAGTCAG AATCTCTTACGGAACTTGTACAACCAGAGATACAGCCACAAGAG TTT

CTTAACAGACGCTATATGACAGAAGTAAAATTTTCAAGAAAACAAGAAAATGTAGAACAATCCTGGGAAGCAGATTATGCTAGGAAACCAAGTCTCCTCA

AATGCTGGAATACACTTCCAGAGCCAGATGGTCAGGAGAAGAAGAAAGAGTCCTTGGAGTCCTGGAAGTCTTCTCTTAAGACTCAGGAGGTATCAAAGCC

TGTGGTTTCCTTAGTACAGGGGAAACTCAGGCCAACATTGCAGGAAGAGCAGAAGCAGCAGGTTCCTATAACACCTGTCAGTCAGTGGAAGCCAGAAAGC

CCTAAGTCCAAAGTGGGCAGTCCTCAAGAAGAGCAGAATGTACAGGAGACACCAAAGCCATGGGTGGTTCAGTCACAGAAAGAACAAGATCCAAAGAAGC

TGCCTCCTGGATCCTGGGCAGTATCTGTGCAGAGTGAACAGAGTGGCAGCAGATCCTGGACCACCCCTGTGTGCAGAGAACAGGCTTCAGTGCAGCCTGG

GACTCCAGTATCCTGGGAAAACAATGCTGAGAACCAGAAACACTCCTTAGTACCACAATCACAGATTTCTCTAAAGTCCTGGGGAGCAGCTTCAGCAGGC

CTCTTACCAAATGGCCAAGTCCTGACGAGGAAGTTAAATGTAGAACCCAAAGAT GTGCCTAAGCCCCTGCCTCAGCCTATAGACTCTTCTTCTGCCCTT

CCAAAGGATCCAGTATTGAGGAAAGAAAAACTGCAGGACCTCATGAGCCAGATTCAAGGAACTTATAACTTTATGCAA GAGTCTGTTCTAGATTTTGAC

AAACCCTCAAGTGCAATTCCATCATCACAGCCGCCTTCAGCTTGTCCAG TCTCTACAGTATCTGCAGAACAAAACTTGTCCAACCAAAGTGATTTTCTT

CAAGAACCATCACAG GCCTCTTCTCCGGTTACTTGTAGCTCAAATGCTTGCTTGGTGACTACTGATCAGGCTTCTTCGGGATCTGAAACAGAGTTTACG

ACCTCAGAGACCCCTGAG ATGGTGGTCTCCCCCTGCAAGCCAAAGCCAGCTTCTGCACTTGCTTCTCCAAATCCTCCCCTGTCAAAGAGCTTCCAGTTA

CCTCCTGCAAGTGGGAGTTCAGAAGCCATTAGCACAGCACCTTTTCAGGCCATGCAGACA - UNI5808 - GTGTTTAATGTTAATGCACCTCTGCCT

CCACGGAAAGAACAAGAAATGAAAGAACCTCCTTATTCATCTGGCTACAATCAAAATTTTACTTCATCAAGTACACAGACAGTATCCCAATGCCAGCTCC

CAGCTGTACACATAGACCAGACAACTCAGCCTCCAGAGACTG - UNI5864 - GTGCAGGTTATCATCCTGATGGAACTGTTCAAGTAAGCAATGGCA

GCCTTGCCTTTTACCCAGCACCCACGAGTATGTTTCCCAGACCTGCTCAGCCATTTATCAGTAGTCGGGGGACTCTGAGAGGGTGTTCACATGGAGGGAG

GTTACTAATGAGTTCCTATCAGTCTCCTGGTGGCTACAAAG GTTTTGATAGTTACAGAGGACTTCCTTCAGTTTCAAGTGGGAATTACAGCCAGCTGCA

GCTGCAAGCTAGAGAATATTCTGGAACAGCTTACTCTCAAAGG GATAATTTCCAGCAGTGTTATAAAAGATCAGGGACATCTAGTGGTCTTCAGGCAAA

TTCAAGAG CAGGGTGGAGTGACTCCTCTCAGGTGAGCAGCCCAGAAAGAGACAGCGAGACTTTTAACAGTGGAGACTCTGGGCTAGGAGACTCTCGGAG

CATGACCCCAGTGGATGTGCCAGTGACAAGCCCAGCAGCCGCCATCCTGCCAGTCCATATCTATCCCCTGCCTCAGCAAATGCGAGTTGCCTTCTCAGCT

GCCAGAACATCCAATCTGGCTCCTGGAACTTTAGACCAACCTATTGTGTTTGATCTTCTCCTGAACAACTTGGGAGAGACCTTTGATCTTCAGCTTGGTA

GATTCAATTGCCCAGTGAATGGCACTTACGTGTTCATTTTTCACATGCTAAAGCTGGCTGTGAATGTACCACTGTATGTCAACCTGATGAAGAATGAGGA

GGTCTTGGTGTCAGCCTATGCCAACGATGGTGCTCCAGACCATGAGACAGCAAGCAACCATGCCGTTCTCCAGCTCCTCCAGGGAGACCAGATATGGCTG

CGCTTACACAGGGGAGCGATTTATGGAAGTAGCTGGAAATACTCTACATTTTCAGGCTATCTTCTTTATCAAGATTAAAATTCAGTTCAGAATAAAAGAA

TGAAGTTCTCACTAGTGGATCTAAGGAAAAGCAGTCCTTGCCCTAGTGATTGACTGGTTGGGAAAAATATTTTTGTTCCTAGAGAAAGAAGGAGGTCCTC

ACTTTTTTGTTTTCCATTTTATGTGAAGACTTTGAAGCAGAATGATAATTAGCACTAACTTTATAAATTGTGATGTAGCCTTGCTAGTCACACAGCGAAT

GTGTATTGTTTGCACTTAATCCTGAACTGTGTTAATGGTCAGCTTACTGAATTGAATGCCTCAACTTCAGATAAGTTACCATGCCTCGTTGTGCCTCAAT

AAAAATTTAAACTGC
Translation
 - UNI22243 - - UNI36587 - MKSAKSQVNQDQQGENQRALSPLQSTLSSAASPSQAYETYIDNGLICLKHKIRNIEKKK - UNI36587 - 

LKLEDYKDRLKNGEQLNPDQL - UNI8123 - - UNI36587 - EAVEKYEEVLHNLEFAKELQKTFSALSQD - UNI17795 - LLKAQKKAQR

REHMLKLETEKKKLRTMLQIQYVLQNLTQEHVQKDFKGGLNGAMYLPSKELDYLIKFSKLTCPERNESLS SVEDQMEQSSLYFWDLLEGSEKTVVGTTY

 YKHVKDLLSKLLHSGYFESVPVLRNSKEKAEEVLMQSEMKKQLLKSESIKESE ESLTELVQPEIQPQE FLNRRYMTEVKFSRKQENVEQSWEADYAR

KPSLLKCWNTLPEPDGQEKKKESLESWKSSLKTQEVSKPVVSLVQGKLRPTLQEEQKQQVPITPVSQWKPESPKSKVGSPQEEQNVQETPKPWVVQSQKE

QDPKKLPPGSWAVSVQSEQSGSRSWTTPVCREQASVQPGTPVSWENNAENQKHSLVPQSQISLKSWGAASAGLLPNGQVLTRKLNVEPKD VPKPLPQPI

DSSSALPKDPVLRKEKLQDLMSQIQGTYNFMQ ESVLDFDKPSSAIPSSQPPSACPV VSTVSAEQNLSNQSDFLQEPSQ ASSPVTCSSNACLVTTDQA

SSGSETEFTTSETPE MVVSPCKPKPASALASPNPPLSKSFQLPPASGSSEAISTAPFQAMQT - UNI5808 - VFNVNAPLPPRKEQEMKEPPYSSG

YNQNFTSSSTQTVSQCQLPAVHIDQTTQPPETG - UNI5864 - GAGYHPDGTVQVSNGSLAFYPAPTSMFPRPAQPFISSRGTLRGCSHGGRLLMSS

YQSPGGYKG GFDSYRGLPSVSSGNYSQLQLQAREYSGTAYSQR DNFQQCYKRSGTSSGLQANSRA AGWSDSSQVSSPERDSETFNSGDSGLGDSRSM

TPVDVPVTSPAAAILPVHIYPLPQQMRVAFSAARTSNLAPGTLDQPIVFDLLLNNLGETFDLQLGRFNCPVNGTYVFIFHMLKLAVNVPLYVNLMKNEEV

LVSAYANDGAPDHETASNHAVLQLLQGDQIWLRLHRGAIYGSSWKYSTFSGYLLYQD
Transcript ENSMUST00000072324
Sequence
GCACTGTCGGCGGTGGCCGCAGGCTAAGCTGAGGCGGGAGGAAGGGACGCGGGGGGAGAAGGGAGTGCGGGGTGGAGTTCGCCCACTTTGCAGCGCGCAG

GACTCCCGCGCGCTTTCGGAGGCAGCCGGGGAG - UNI22243 - - UNI36587 - TCACCTTCAGGCCGGCCATTCAGAGGAGGGAAAAGTGGGA

AGTATGAAGTCAGCCAAGTCCCAAGTGAACCAGGATCAGCAAGGGGAAAACCAGCGGGCTCTGAGCCCCCTGCAGTCTACTCTCAGTTCTGCTGCATCTC

CTTCCCAGGCATATGAAACCTATATTGATAATGGACTTATATGCCTTAAACACAAAATTAGGAACATCGAGAAGAAGAAG - UNI36587 - CTCAAA

CTGGAAGATTATAAAGATCGCCTTAAAAATGGAGAGCAGCTTAACCCAGACCAGTTG - UNI8123 - - UNI36587 - GAAGCAGTAGAAAAGTA

TGAAGAAGTACTTCATAATTTGGAATTTGCCAAGGAGCTTCAGAAAACTTTTTCTGCACTGAGCCAAGAT - UNI17795 - CTGCTGAAAGCGCAGA

AAAAGGCCCAGAGAAGGGAGCATATGCTGAAACTTGAGACTGAGAAGAAAAAGCTTCGAACTATGCTTCAAATTCAGTATGTATTACAGAATTTGACACA

AGAACATGTACAAAAAGACTTCAAAGGGGGCTTGAATGGTGCAATGTATTTGCCTTCAAAAGAACTTGACTACCTCATTAAATTCTCAAAACTGACCTGC

CCTGAAAGAAATGAAAGTCTGAG TGTTGAAGACCAGATGGAGCAGTCATCCTTGTACTTTTGGGACCTTTTGGAAGGTAGTGAAAAAACAGTGGTAGGA

ACAACAT ATAAACATGTGAAAGACCTGCTGTCTAAATTGCTGCACTCAGGTTATTTTGAAAGTGTCCCAGTTCTCAGGAATTCTAAGGAAAAAGCAGAA

GAAGTGCTAATGCAATCAGAAATGAAAAAACAGTTACTGAAGAGTGAGTCTATCAAAGAGTCAG AATCTCTTACGGAACTTGTACAACCAGAGATACAG

CCACAAGAG GTGCCTAAGCCCCTGCCTCAGCCTATAGACTCTTCTTCTGCCCTTCCAAAGGATCCAGTATTGAGGAAAGAAAAACTGCAGGACCTCATG

AGCCAGATTCAAGGAACTTATAACTTTATGCAA GAGTCTGTTCTAGATTTTGACAAACCCTCAAGTGCAATTCCATCATCACAGCCGCCTTCAGCTTGT

CCAG TCTCTACAGTATCTGCAGAACAAAACTTGTCCAACCAAAGTGATTTTCTTCAAGAACCATCACAG GCCTCTTCTCCGGTTACTTGTAGCTCAAA

TGCTTGCTTGGTGACTACTGATCAGGCTTCTTCGGGATCTGAAACAGAGTTTACGACCTCAGAGACCCCTGAG ATGGTGGTCTCCCCCTGCAAGCCAAA

GCCAGCTTCTGCACTTGCTTCTCCAAATCCTCCCCTGTCAAAGAGCTTCCAGTTACCTCCTGCAAGTGGGAGTTCAGAAGCCATTAGCACAGCACCTTTT

CAGGCCATGCAGACA - UNI5808 - GTGTTTAATGTTAATGCACCTCTGCCTCCACGGAAAGAACAAGAAATGAAAGAACCTCCTTATTCATCTGGC

TACAATCAAAATTTTACTTCATCAAGTACACAGACAGTATCCCAATGCCAGCTCCCAGCTGTACACATAGACCAGACAACTCAGCCTCCAGAGACTG - 

UNI5864 - GTGCAGGTTATCATCCTGATGGAACTGTTCAAGTAAGCAATGGCAGCCTTGCCTTTTACCCAGCACCCACGAGTATGTTTCCCAGACCTG

CTCAGCCATTTATCAGTAGTCGGGGGACTCTGAGAGGGTGTTCACATGGAGGGAGGTTACTAATGAGTTCCTATCAGTCTCCTGGTGGCTACAAAG GTT

TTGATAGTTACAGAGGACTTCCTTCAGTTTCAAGTGGGAATTACAGCCAGCTGCAGCTGCAAGCTAGAGAATATTCTGGAACAGCTTACTCTCAAAGG G

ATAATTTCCAGCAGTGTTATAAAAGATCAGGGACATCTAGTGGTCTTCAGGCAAATTCAAGAG CAGGGTGGAGTGACTCCTCTCAGGTGAGCAGCCCAG

AAAGAGACAGCGAGACTTTTAACAGTGGAGACTCTGGGCTAGGAGACTCTCGGAGCATGACCCCAGTGGATGTGCCAGTGACAAGCCCAGCAGCCGCCAT

CCTGCCAGTCCATATCTATCCCCTGCCTCAGCAAATGCGAGTTGCCTTCTCAGCTGCCAGAACATCCAATCTGGCTCCTGGAACTTTAGACCAACCTATT

GTGTTTGATCTTCTCCTGAACAACTTGGGAGAGACCTTTGATCTTCAGCTTGGTAGATTCAATTGCCCAGTGAATGGCACTTACGTGTTCATTTTTCACA

TGCTAAAGCTGGCTGTGAATGTACCACTGTATGTCAACCTGATGAAGAATGAGGAGGTCTTGGTGTCAGCCTATGCCAACGATGGTGCTCCAGACCATGA

GACAGCAAGCAACCATGCCGTTCTCCAGCTCCTCCAGGGAGACCAGATATGGCTGCGCTTACACAGGGGAGCGATTTATGGAAGTAGCTGGAAATACTCT

ACATTTTCAGGCTATCTTCTTTATCAAGATTAAAATTCAGTTCAGAATAAAAGAATGAAGTTCTCACTAGTGGATCTAAGGAAAAGCAGTCCTTGCCCTA

GTGATTGACTGGTTGGGAAAAATATTTTTGTTCCTAGAGAAAGAAGGAGGTCCTCACTTTTTTGTTTTCCATTTTATGTGAAGACTTTGAAGCAGAATGA

TAATTAGCACTAACTTTATAAATTGTGATGTAGCCTTGCTAGTCACACAGCGAATGTGTATTGTTTGCACTTAATCCTGAACTGTGTTAATGGTCAGCTT

ACTGAATTGAATGCCTCAACTTCAGATAAGTTACCATGCCTCGTTGTGCCTCAATAAAAATTTAAACTGC
Translation
 - UNI22243 - - UNI36587 - MKSAKSQVNQDQQGENQRALSPLQSTLSSAASPSQAYETYIDNGLICLKHKIRNIEKKK - UNI36587 - 

LKLEDYKDRLKNGEQLNPDQL - UNI8123 - - UNI36587 - EAVEKYEEVLHNLEFAKELQKTFSALSQD - UNI17795 - LLKAQKKAQR

REHMLKLETEKKKLRTMLQIQYVLQNLTQEHVQKDFKGGLNGAMYLPSKELDYLIKFSKLTCPERNESLS SVEDQMEQSSLYFWDLLEGSEKTVVGTTY

 YKHVKDLLSKLLHSGYFESVPVLRNSKEKAEEVLMQSEMKKQLLKSESIKESE ESLTELVQPEIQPQE VPKPLPQPIDSSSALPKDPVLRKEKLQDL

MSQIQGTYNFMQ ESVLDFDKPSSAIPSSQPPSACPV VSTVSAEQNLSNQSDFLQEPSQ ASSPVTCSSNACLVTTDQASSGSETEFTTSETPE MVVS

PCKPKPASALASPNPPLSKSFQLPPASGSSEAISTAPFQAMQT - UNI5808 - VFNVNAPLPPRKEQEMKEPPYSSGYNQNFTSSSTQTVSQCQLPA

VHIDQTTQPPETG - UNI5864 - GAGYHPDGTVQVSNGSLAFYPAPTSMFPRPAQPFISSRGTLRGCSHGGRLLMSSYQSPGGYKG GFDSYRGLPS

VSSGNYSQLQLQAREYSGTAYSQR DNFQQCYKRSGTSSGLQANSRA AGWSDSSQVSSPERDSETFNSGDSGLGDSRSMTPVDVPVTSPAAAILPVHIY

PLPQQMRVAFSAARTSNLAPGTLDQPIVFDLLLNNLGETFDLQLGRFNCPVNGTYVFIFHMLKLAVNVPLYVNLMKNEEVLVSAYANDGAPDHETASNHA

VLQLLQGDQIWLRLHRGAIYGSSWKYSTFSGYLLYQD

For any suggestions or comments, please send an email to unitrap@crg.es