Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030314 (Atg7)
Chromosomal location
Chr 6: 114593149 - 114810613 (+)
Description
autophagy-related 7 (yeast) Gene [Source:MGI Symbol;Acc:MGI:1921494]
RefSeq_dna
NM_028835 
RefSeq_peptide
NP_083111.1 
UniGene
Mm.275332 Mm.475285 
MGI
MGI:1921494 
Uniprot/SWISSPROT
Q9D906 
Uniprot/SPTREMBL
Q3TAB9 Q3TM87 
Human Ortholog
not available
Omim not available
UniTrap UNI2557
Vector Insertion
Chr 6: 114727098 - 114809008
Public Clones XS0386 (sanger) RRJ470 (baygenomics) RRT058 (baygenomics) CMHD-GT_181E5-3 (cmhd)
Private Clones OST31886 (lexicon) OST29781 (lexicon) OST29218 (lexicon) OST28930 (lexicon)
OST27358 (lexicon) OST25218 (lexicon) OST24122 (lexicon) OST21969 (lexicon)
OST21689 (lexicon) OST20972 (lexicon) OST20430 (lexicon) OST19412 (lexicon)
OST18156 (lexicon) OST17953 (lexicon) OST17652 (lexicon) OST16121 (lexicon)
OST15620 (lexicon) OST14886 (lexicon) OST14821 (lexicon) OST13448 (lexicon)
OST13071 (lexicon) OST3509 (lexicon)
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000032457
Sequence
GTGGTTGCCGGAAGTTGAGCGGCG GCTGGTAAGAACAGTAGCCATGGGGGACCCTGGACTGGCCAAGTTGCAGTTCGCCCCCTTTAATAGTGCCCTGGA

CGTTGGCTTCTGGCACGAACTGACCCAGAAGAAGTTGAACGAGTACCGCCTGGACGAGGCACCCAAAGACATCAAGGGCTATTACTACAATG GTGACTC

TGCTGGTCTGCCCACCCGCTTGACGTTGGAGTTCAGTGCTTTTGACAT GAGTGCCTCCACGCCTGCCCACTGCTGCCCGGCCATGGGAACCCTGCACAA

CACCAACACACTTGAGGCTTTTAAGACAGCAGACAAGAAGCTCCTTCTGGAGCAGTCAGCAAATGAG ATCTGGGAAGCCATAAAGTCAGGTGCTGCTCT

CGAAAACCCCATGCTCCTCAACAAGTTTCTGCTCCTGACCTTCGCG GACCTAAAGAAGTACCACTTCTACTACTGGTTTTGCTGCCCCGCCCTCTGTCT

TCCTGAGAGCATCCCTCTAATCCGGGGACCTGTGAGCTTGGATCAAAGGCTTTCACCAAAACAG ATCCAGGCCCTGGAGCATGCCTATGATGATCTGTG

TCGAGCCGAAGGCGTCACGGCCCTGCCCTACTTCTTATTCAAGTACGATGACGACACTGTTCTGGTCTCCTTGCTCAAACACTACAGTGATTTCTTCCAA

GGTCAAAGGACAAAG ATAACAGTTGGTGTGTACGATCCCTGTAACCTAGCCCAGTACCCTGGATGGCCTTTGAGGAATTTTTTGGTCCTGGCAGCCCAC

AGATG GAGCGGCAGTTTCCAGTCCGTTGAAGTCCTCTGCTTTCGGGACCGCACCATGCAGGGAGCTAGAGACGTGACACATAGCATCATCTTTGAAGTG

AAACTTCCAGAAATGGCATTTAGCCCAG ATTGTCCTAAAGCTGTTGGCTGGGAGAAGAACCAGAAAGGAGGCATGGGTCCGAGGATGGTGAACCTCAGT

GGATGTATGGACCCCAAAAG GCTGGCTGAGTCATCTGTGGATCTGAATCTCAAGCTGATGTGCTGGCGATTGGTCCCCACCTTGGACTTGGACAAGGTC

GTGTCTGTCAAGTGCCTGCTGCTGGGAGCTGGTACCTTGGGGTGTAATGTGGCTAGGACACTGATG GGCTGGGGCGTCAGACATGTCACCTTTGTGGAT

AACGCCAAGATCTCCTACTCCAATCCCGTGAGGCAGCCTCTGTATGAATTTGAAGATTGTCTAGGGGGTGGCAAGCCCAAGGCCCTGGCTGCAGCAGAGC

GGCTACAGAAAATATTTCCCGGAGTG AATGCCAGAGGGTTCAACATGAGCATCCCCATGCCAGGACACCCTGTGAACTTCTCTGACGTCACGATGGAGC

AGGCCCGCAGAGATGTGGAGCAGCTGGAGCAGCTCATTGATAACCATGATGTCATCTTCCTGCTAATGGACACCAGGGAGAGCCGGTGGCTTCCTACTGT

TATTGCAGCCAGCAAGCGAAAG CTGGTCATCAACGCTGCCTTGGGGTTTGATACCTTTGTTGTCATGAGACATGGCCTGAAGAAACCCAAGCAGCAGGG

AGCCGGAGACCTCTGCCCAAGCCATCTTGTAGCACCTGCTGACCTGGGCTCCTCACTTTTTGCCAACATCCCTGGATACAAGCTTGGCTGCTACTTCTGC

AATGATGTGGTGGCTCCAGGAGAT TCAACCAGAGACCGGACTCTGGACCAGCAGTGCACAGTGAGCCGCCCAGGCCTGGCCGTGATTGCAGGTGCCCTG

GCTGTGGAGCTGATGGTCTCTGTCCTGCAGCATCCTGAGGG GGGCTACGCCATCGCCAGCAGCAGTGATGACCGCATGAATGAGCCTCCCACCTCGCTG

GGACTTGTGCCTCACCAG ATCCGGGGTTTTCTGTCACGGTTCGATAATGTTCTTCCTGTCAGCCTGGCATTTGATAAATGTACAGCCTGTTCACCCAAA

 GTTCTTGATCAGTACGAGCGAGAAGGATTCACCTTCCTAGCGAAGGTTTTTAACTCCTCACATTCCTTCTTAGAAGACTTGACCGGTCTTACCCTGCTC

CATCAAGAGACCCAAGCTGCTGAG - UNI2557 - ATCTGGGACATGAGTGACGAGGAGACTGTCTGAAGCAAGCAACCACAGCTCAGGAGTACCTGG

CCCTCAGCGCAGGACTGGACCGCAGGACTGGTGATCTGGGCCCTGCCACCTCCCTGGTCCTGATCTCCACATCTCCAAGGACGAGGGTGTACCCTCTGCC

ACCCAGTTGCACCCTTTCCTGTGCCATCTCACCAGCTCTGAACTCAATAATAACCTTGGCATTGCCACTGATCTGGGGCTCAGGTCCTTCCATGTGCACT

AATCTCCCCCCCCCCACACACACACTGTTGCTGAAGGACACCCCAGGACCCAACATAGATCAGACAAGGCTGTGCTAGGAGCCTCACCGGTAGGGCACCT

GCTCTGGGCCCTGGGTAGCAGTGAGTGCTGAGTTTGTAGCCTCAAGTGTTCAAGTGGCACACCAAGCCACCCTCCCCCAGCTGTGGGCATGCTGTGTGCC

ACCCTGTTCCAGGGATGGGAGAAGCTCCTGCCACAGCCCTGTACTGAAAAGCAGGGAAGAGCTCTGTAGGATGGGTGTGTCCAGCTGGGCCTAGTCAGGT

GCCCTCACTCACGGGGTTGCTCCTGGGGCAAGGCTTGTCTTCCTCTTCACTCTGGGTGGGCCCTTGGCAGCTGTGGCCACCCATCCTAAATAGATGAGCT

GCTCCCCTCCCACACCTGTGCACCTTCACTGGGGTCTCAGGTCCAGAACAGAAGCCCATGCACGGCTGGCTTAGCAGGTCTCAGGAAGGGAGACTAGAGA

GGACCTTGGCCTAACACAGATGCTGCAACAAGCGGCCCTACCATCTGTGCAAGGCTCCCCACAAGTAGCCAGGCCTACCTGGGCACAGGGCCCCACAGCC

CACATGCCACCCTAGGAGTCAAGAGCCACACAGCCTCGGTTTAAGAGCACTTTATTATTGTTCTTAAGGCTACTTTTAAGTACAAAAAAAAAAAAAAAAA

AAAAAAAAAAAAGATGGCCTGCCAAACCTTTTTTTTTTTCTTCTTCCAGGAAAAAAAAACAGGCCACAGAAAATGGTATATTACAGATTTACAAACACAG

AGGGGTCAGCACACACATAGATGGCTTGGTTCTGGGGAGGTCGCAAGCTCCTGCCCAAGCGGGCTGGCAGGCTCCTCAGCTGACAAATGAGGTATCCCAC

TCCAGGGCACGGCCTATTCCAGATAGGTCAGCGCACCAGGGACCCAGCCACCCGCACTGCCATCCCCCCCTCCCCCAACAGCGACGACCCGCTCACTGAC

GGGTATCTGAGGCCCGTTGCCCACAGAGCCAGTCCGCGGTGCGGTTGTTTTCCTGTGACAACCTCAGTAGCCTGTAGAATAACAAACTAGTGGCTATTAA

TGCGGACGCAGTGTTGTCATGGAGTAACTGTGTACCTGCACGATTACAGACACACCTACGACAAAAAAGATCAACTTTTTTCCCCCAAACAACAACAACA

AAAAAATGAATGATTATGATAGGAAAGGGAAAATTAAATAGCTACATATCATTAACAAATTAATTGTTCTTCAAAAAATACCTACAAATTTCTCTGTACA

TTCTTTACGCACAGCGTAATGATGGTCTTTAAAATTACCTAT
Translation
 MGDPGLAKLQFAPFNSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNG GDSAGLPTRLTLEFSAFDM MSASTPAHCCPAMGTLHNTNTLEAFKTA

DKKLLLEQSANE IWEAIKSGAALENPMLLNKFLLLTFA DLKKYHFYYWFCCPALCLPESIPLIRGPVSLDQRLSPKQ IQALEHAYDDLCRAEGVTAL

PYFLFKYDDDTVLVSLLKHYSDFFQGQRTK ITVGVYDPCNLAQYPGWPLRNFLVLAAHRW WSGSFQSVEVLCFRDRTMQGARDVTHSIIFEVKLPEMA

FSPD DCPKAVGWEKNQKGGMGPRMVNLSGCMDPKR RLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLLLGAGTLGCNVARTLM GWGVRHVTFVDNA

KISYSNPVRQPLYEFEDCLGGGKPKALAAAERLQKIFPGV NARGFNMSIPMPGHPVNFSDVTMEQARRDVEQLEQLIDNHDVIFLLMDTRESRWLPTVI

AASKRK LVINAALGFDTFVVMRHGLKKPKQQGAGDLCPSHLVAPADLGSSLFANIPGYKLGCYFCNDVVAPGD STRDRTLDQQCTVSRPGLAVIAGAL

AVELMVSVLQHPEG GGYAIASSSDDRMNEPPTSLGLVPHQ IRGFLSRFDNVLPVSLAFDKCTACSPK VLDQYEREGFTFLAKVFNSSHSFLEDLTGL

TLLHQETQAAE - UNI2557 - IWDMSDEETV

For any suggestions or comments, please send an email to unitrap@crg.es