Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030323 (Ift122)
Chromosomal location
Chr 6: 115803488 - 115876717 (+)
Description
intraflagellar transport 122 homolog (Chlamydomonas) Gene [Source:MGI (curated);Acc:Ift122-001]
RefSeq_dna
NM_031177 
RefSeq_peptide
NP_112454.1 
MGI
MGI:1932386 
Uniprot/SPTREMBL
Q9ERM4 Q6KAU2 Q6NWV3 Q8C5U2 Q8CD77 Q8C8U5 
Human Ortholog
ENSG00000163913 (IFT122)
Omim not available
UniTrap UNI25363
Vector Insertion
Chr 6: 115803728 - 115812732
Public Clones IST14649E9 (tigm)
Private Clones OST186677 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112923
Sequence
TCCCTTTTGTACATGCGCACTTGGAGCTTTGGGAAACTCATGCGCGGTTCATTGCGCATGTGCGTTGCTAAGGGTAGCGCAGGTAGCTGAAGTGGTTTGT

GGAAAGAAGCCTGTTGCTGCCGAGGCTGGGAGGAGGGGCCCGAAGCGTGAGGGAAACGGCGATGAGGGCCGTGTTGACGTGGAGAGACAAAGCGGAGCAG

TG - UNI25363 - TATCTACGACCTCGCATTTAAGCCTGATGGAACACAACTGATTCTGGCTGCAGGAAACAGATTGCTG GTTTATGACACCTCTG

ATGGCACCTTACTTCAGCCCCTGAAGGGACACAAAGACACCGTGTACTGTGTGGCGTATGCAAAGGATG GCAAGCGCTTTGCATCTGGATCTGCTGACA

AGAGCATCATTATCTGGACCTCAAAACTTGAAGGCATTCTGAAGTACAC GCACAACGACTCTATACAGTGTGTCTCCTACAATCCTGTTACCCACCAGC

TGGCATCTTGTTCCTCCAGTGACTTTG GGTTATGGTCTCCTGAGCAGAAGTCTGTGTCCAAGCACAAATCCAGCAGCAAGATCACGTGCTGCAG CTGG

ACAAACGATGGTCAGTACCTGGCTCTGGGCATGGCCAATGGCATCATCAGTATACGGAACAAGAATGGTGAAGAGAAAGTGAAGATCGAGCGCCCTGGGG

GCTCCCTCTCCCCAATATGGTCCATCTGCTGGAACCCTTCAAG CCGATGGGAGACTATCTGGATGAGCAGAGAGAACGAGGATGCTGAGGATGTCATTG

TCAACAAATATGTTCAGGAAATCCCTTCCATTCTGAAGTCAACAGTGTACAATAGTCAGGGTAGTGAGGCAGAGGAGGAAGAGCAAGAGGAAGAGGACGA

CAGTCCCAGGGACGGCAACTC AGAGGAACATAATGACATCCTGGCTGTAGCTGACTGGGGACAGAAACTTTCCTTCTACCAGCTGAGTGGAAAACAG A

TTGGGAAGGATCGGCCACTGAACTTTGACCCCTGTTGCATCAGCTACTTCACTAAAGGAGAGTACATTTTGGTGGGAGGTTCAGACAAGCAGGTATCTCT

TTTCACCAAGGATGGAGTGCGACTGGGGACCGTTGGGGAGCAGAACTCCTGGGTGTGGACCTGTAGAGTGAAACCTGACTCCAATTATGTG GTGGTCGG

CTGCCAGGATGGCACCATCTCCTTCTACCAGCTCATCTTCAGCACAGTCCATGGGCTCTACAAAGATCGGTATGCCTACAGGGACAGCATGACAGACGTC

ATCGTGCAGCACCTCATCACAGAGCAGAAAG TTAGGATTAAGTGCAGAGAGCTTGTCAAGAAAATTGCCATCTACAAAAATCGATTAGCTATCCAGCTG

CCAGAGAAGATCCTCATCTACGAGCTGTACTCTGAAGACTCGACAGACATGCACTACCGGGTAAAGGAGAAAATTGTCAAGAAGTTTGAGTGCAACCTGC

TGGTGGTGTGTGCTGACCACATCATCCTGTGCCAG GAGAAACGGCTACAGTGCCTGTCCTTCAGTGGAGTGAAGGAAAGGGAATGGCAGATGGAATCTC

TCATCCGCTACATCAAGGTGATCGGTGGCCCTGCTGGAAGAGAAGGTCTGTTGGTAGGCCTGAAAAACGGCCAG ATCCTGAAGATCTTTGTGGACAATC

TTTTTGCTATTGTCCTGCTGAAGCAGGCCACAGCCGTGCGCTGCCTGGACATGAGTGCCTCCCGGAACAAGCTGGCTGTGGTGGATGAGAATGACACGTG

CCTGGTGTACGACATCCACACGAAGGAACTGCTTTTCCAG GAACCGAATGCTAACAGCGTGGCCTGGAACACGCAGTGTGAGGACATGCTCTGCTTCTC

TGGAGGAGGCTACCTCAACATCAAGGCCAGCACCTTCCCAGTGCACCAGCAGAAGCTGCAGGGCTTTGTGGTTGGCTACAACGGCTCCAAGATCTTCTGC

CTTCATGTCTTCTCTATGTCTGCCGTGGAGGTGCCACAG TCCGCTCCAATGTACCAGTACCTCGATAGGAAGATGTTCAAAGAAGCATATCAGATCGCT

TGCTTGGGAGTGACAGACGCTGATTGGCGTGAACTGGCCATGGAAGCTCTAGAAGGACTAGAGTTTGAGACGGCAAGGAAG GCCTTCACCAGAGTCCAG

GACCTTCGATACCTAGAACTGATCAGCAGTATTGAG GAGAGGAAGAAGAGGGGAGAGACCAACAATGACCTGTTTCTGGCAGATGTGTTTTCCTACCAG

GGGAAGTTTCATGAAGCCGCCAAACTATACAAGAGGAGCGGGCATGAGAACCTCGCTCTCGACATGTATACTGACCTCTGCATGTTTGAGTACGCCAAG 

GATTTCCTTGGATCTGGAGACCCTAAAGAAACGAAGATGCTCATCACCAAGCAGGCCGACTGGGCCAGAAACATCAATGAGCCCAAAGCTGCAGTGGAGA

TGTACATCTCAGCAGGGGAGCACGCCAAGGCCATAGAGATCAGCGGCAGCCATGGCTGGGTGGACAT GTTGATAGACATTGCTCGGAAGCTGGACAAGG

CTGAACGGGAGCCCCTGCTCATGTGTGCTTGCTACTTTAAGAAGCTGGACAGTCCTGGCTATGCTGCTGAGACCTACCTGAAGATCGGGGACCTGAAGTC

TCTGGTGCAGCTGTATGTGGACACCAAGCGCTGGGATGAG GCCTTTGCGTTAGGTGAGAAGCACCCGGAGTTCAAGGATGACGTCTACGTGCCCTACGC

GCAGTGGCTGGCGGAGAACGACCGCTTTGAGGAAGCCCAGAAAG CCTTCCACAAGGCCGGGAGGCAGGGAGAAGCAGTCCGGGTGCTGGAGCAGCTCAC

GCACAATGCTGTGGTGGAGAGCAGGTTTAACGACGCTGCCTATTATTACTGGATGCTGTCCATGCAGTGCCTCGACATGGCTCAAG ATCCTGCCCAGAA

GGACGCGATGCTGGACAAGTTTCACCACTTCCAACACCTGGCTGAGCTGTACCATGGCTATCAAACCATTCACCGATACACG GAGGAGCCATTCAGCTT

TGACCTCCCTGAAACCCTCTTCAACATCTCCAAGTTCTTGCTGCACAGCCTGACCAAGGCCACCCCCTTGGGTATCTCCAAAGT CAGGAATACACTCTT

CACACTGGCTAAGCAGAGCAAGGCTCTGGGTGCTTACAAGCTGGCCCGGCATGCCTATGACAAGCTACGGGGGCTGCAGATCCCCGCCAGGATCCAGAAG

TCCATTGAGCTGGGCACCCTGACCATCCGCTCCAAGCCCTTCCATGACAGTGAG GAGCTGGTACCCTTGTGCTACCGCTGTTCTACCAACAACCCGCTG

CTGAACAACCTTGGCAACGTCTGCATCAACTGCCGCCAGCCCTTCATCTTCTCCGCCTCTTCCTATG AGGTGCTGCACCTGGTGGAATTCTACCTGGAA

GAGGGGATCACTGACGAAGAAGCTGTTGCCCTCATCGATCTGGAGGCACCAAGACACAAGAGGGAGGGCAAGTGGCGAGAGACCTCAAGCAACA ATTCC

CAGACGTTGAAGCTGGACGAGACCATGGACTCCATAGGAGAAGATGACCCATTTACAGCCAAGCTGAGCTTTGAG CAAGGTAGCTCTGAGTTTGTGCCT

GTGGTGGTGAACCGGTCAGTACTACGCTCCATGAGCCGAAGAGATGTTCTCATCAAGCGCTGGCCCCCGCCGCTGCAATGGCAATATTTCCGCTCGCTGT

TGCCTGATGCCTCCATCACCATGTGCCCCTCCTGCTTTCAG ATGTTCCATTCAGAGGACTACGAACTGCTTGTGCTCCAGCACGCCTGCTGCCCTTACT

GCCGAAGGCGTATCGACGACACTGGCCCGTGAGCAGCGACAGCCTCTGGGACCACGGCTCCCATGGTCTCCTTGCTGTCCCCAGACTGTTGGGAGAAGGA

ATTAAAC
Translation
MRAVLTWRDKAEQC - UNI25363 - CIYDLAFKPDGTQLILAAGNRLL VYDTSDGTLLQPLKGHKDTVYCVAYAKDG GKRFASGSADKSIIIWTS

KLEGILKYT THNDSIQCVSYNPVTHQLASCSSSDFG GLWSPEQKSVSKHKSSSKITCCS SWTNDGQYLALGMANGIISIRNKNGEEKVKIERPGGSL

SPIWSICWNPSS SRWETIWMSRENEDAEDVIVNKYVQEIPSILKSTVYNSQGSEAEEEEQEEEDDSPRDGNS SEEHNDILAVADWGQKLSFYQLSGKQ

 IGKDRPLNFDPCCISYFTKGEYILVGGSDKQVSLFTKDGVRLGTVGEQNSWVWTCRVKPDSNYV VVGCQDGTISFYQLIFSTVHGLYKDRYAYRDSMT

DVIVQHLITEQKV VRIKCRELVKKIAIYKNRLAIQLPEKILIYELYSEDSTDMHYRVKEKIVKKFECNLLVVCADHIILCQ EKRLQCLSFSGVKEREW

QMESLIRYIKVIGGPAGREGLLVGLKNGQ ILKIFVDNLFAIVLLKQATAVRCLDMSASRNKLAVVDENDTCLVYDIHTKELLFQ EPNANSVAWNTQCE

DMLCFSGGGYLNIKASTFPVHQQKLQGFVVGYNGSKIFCLHVFSMSAVEVPQ SAPMYQYLDRKMFKEAYQIACLGVTDADWRELAMEALEGLEFETARK

 AFTRVQDLRYLELISSIE ERKKRGETNNDLFLADVFSYQGKFHEAAKLYKRSGHENLALDMYTDLCMFEYAK DFLGSGDPKETKMLITKQADWARNI

NEPKAAVEMYISAGEHAKAIEISGSHGWVDM MLIDIARKLDKAEREPLLMCACYFKKLDSPGYAAETYLKIGDLKSLVQLYVDTKRWDE AFALGEKHP

EFKDDVYVPYAQWLAENDRFEEAQKA AFHKAGRQGEAVRVLEQLTHNAVVESRFNDAAYYYWMLSMQCLDMAQD DPAQKDAMLDKFHHFQHLAELYHG

YQTIHRYT EEPFSFDLPETLFNISKFLLHSLTKATPLGISKV VRNTLFTLAKQSKALGAYKLARHAYDKLRGLQIPARIQKSIELGTLTIRSKPFHDS

E ELVPLCYRCSTNNPLLNNLGNVCINCRQPFIFSASSYE EVLHLVEFYLEEGITDEEAVALIDLEAPRHKREGKWRETSSNN NSQTLKLDETMDSIG

EDDPFTAKLSFE QGSSEFVPVVVNRSVLRSMSRRDVLIKRWPPPLQWQYFRSLLPDASITMCPSCFQ MFHSEDYELLVLQHACCPYCRRRIDDTGP
Transcript ENSMUST00000112925
Sequence
GTCCCTACGCGCCCGGCGCTTCGGCGGAGGAGGTGGGCTCCCTTTTGTACATGCGCACTTGGAGCTTTGGGAAACTCATGCGCGGTTCATTGCGCATGTG

CGTTGCTAAGGGTAGCGCAGGTAGCTGAAGTGGTTTGTGGAAAGAAGCCTGTTGCTGCCGAGGCTGGGAGGAGGGGCCCGAAGCGTGAGGGAAACGGCGA

TGAGGGCCGTGTTGACGTGGAGAGACAAAGCGGAGCAGTG - UNI25363 - TATCTACGACCTCGCATTTAAGCCTGATGGAACACAACTGATTCTG

GCTGCAGGAAACAGATTGCTG GTTTATGACACCTCTGATGGCACCTTACTTCAGCCCCTGAAGGGACACAAAGACACCGTGTACTGTGTGGCGTATGCA

AAGGATG GCAAGCGCTTTGCATCTGGATCTGCTGACAAGAGCATCATTATCTGGACCTCAAAACTTGAAGGCATTCTGAAGTACAC GCACAACGACTC

TATACAGTGTGTCTCCTACAATCCTGTTACCCACCAGCTGGCATCTTGTTCCTCCAGTGACTTTG GGTTATGGTCTCCTGAGCAGAAGTCTGTGTCCAA

GCACAAATCCAGCAGCAAGATCACGTGCTGCAG CTGGACAAACGATGGTCAGTACCTGGCTCTGGGCATGGCCAATGGCATCATCAGTATACGGAACAA

GAATGGTGAAGAGAAAGTGAAGATCGAGCGCCCTGGGGGCTCCCTCTCCCCAATATGGTCCATCTGCTGGAACCCTTCAAG AGAGGAACATAATGACAT

CCTGGCTGTAGCTGACTGGGGACAGAAACTTTCCTTCTACCAGCTGAGTGGAAAACAG ATTGGGAAGGATCGGCCACTGAACTTTGACCCCTGTTGCAT

CAGCTACTTCACTAAAGGAGAGTACATTTTGGTGGGAGGTTCAGACAAGCAGGTATCTCTTTTCACCAAGGATGGAGTGCGACTGGGGACCGTTGGGGAG

CAGAACTCCTGGGTGTGGACCTGTAGAGTGAAACCTGACTCCAATTATGTG GTGGTCGGCTGCCAGGATGGCACCATCTCCTTCTACCAGCTCATCTTC

AGCACAGTCCATGGGCTCTACAAAGATCGGTATGCCTACAGGGACAGCATGACAGACGTCATCGTGCAGCACCTCATCACAGAGCAGAAAG TTAGGATT

AAGTGCAGAGAGCTTGTCAAGAAAATTGCCATCTACAAAAATCGATTAGCTATCCAGCTGCCAGAGAAGATCCTCATCTACGAGCTGTACTCTGAAGACT

CGACAGACATGCACTACCGGGTAAAGGAGAAAATTGTCAAGAAGTTTGAGTGCAACCTGCTGGTGGTGTGTGCTGACCACATCATCCTGTGCCAG GAGA

AACGGCTACAGTGCCTGTCCTTCAGTGGAGTGAAGGAAAGGGAATGGCAGATGGAATCTCTCATCCGCTACATCAAGGTGATCGGTGGCCCTGCTGGAAG

AGAAGGTCTGTTGGTAGGCCTGAAAAACGGCCAG ATCCTGAAGATCTTTGTGGACAATCTTTTTGCTATTGTCCTGCTGAAGCAGGCCACAGCCGTGCG

CTGCCTGGACATGAGTGCCTCCCGGAACAAGCTGGCTGTGGTGGATGAGAATGACACGTGCCTGGTGTACGACATCCACACGAAGGAACTGCTTTTCCAG

 GAACCGAATGCTAACAGCGTGGCCTGGAACACGCAGTGTGAGGACATGCTCTGCTTCTCTGGAGGAGGCTACCTCAACATCAAGGCCAGCACCTTCCCA

GTGCACCAGCAGAAGCTGCAGGGCTTTGTGGTTGGCTACAACGGCTCCAAGATCTTCTGCCTTCATGTCTTCTCTATGTCTGCCGTGGAGGTGCCACAG 

TCCGCTCCAATGTACCAGTACCTCGATAGGAAGATGTTCAAAGAAGCATATCAGATCGCTTGCTTGGGAGTGACAGACGCTGATTGGCGTGAACTGGCCA

TGGAAGCTCTAGAAGGACTAGAGTTTGAGACGGCAAGGAAG GCCTTCACCAGAGTCCAGGACCTTCGATACCTAGAACTGATCAGCAGTATTGAG GAG

AGGAAGAAGAGGGGAGAGACCAACAATGACCTGTTTCTGGCAGATGTGTTTTCCTACCAGGGGAAGTTTCATGAAGCCGCCAAACTATACAAGAGGAGCG

GGCATGAGAACCTCGCTCTCGACATGTATACTGACCTCTGCATGTTTGAGTACGCCAAG GATTTCCTTGGATCTGGAGACCCTAAAGAAACGAAGATGC

TCATCACCAAGCAGGCCGACTGGGCCAGAAACATCAATGAGCCCAAAGCTGCAGTGGAGATGTACATCTCAGCAGGGGAGCACGCCAAGGCCATAGAGAT

CAGCGGCAGCCATGGCTGGGTGGACAT GTTGATAGACATTGCTCGGAAGCTGGACAAGGCTGAACGGGAGCCCCTGCTCATGTGTGCTTGCTACTTTAA

GAAGCTGGACAGTCCTGGCTATGCTGCTGAGACCTACCTGAAGATCGGGGACCTGAAGTCTCTGGTGCAGCTGTATGTGGACACCAAGCGCTGGGATGAG

 GCCTTTGCGTTAGGTGAGAAGCACCCGGAGTTCAAGGATGACGTCTACGTGCCCTACGCGCAGTGGCTGGCGGAGAACGACCGCTTTGAGGAAGCCCAG

AAAG CCTTCCACAAGGCCGGGAGGCAGGGAGAAGCAGTCCGGGTGCTGGAGCAGCTCACGCACAATGCTGTGGTGGAGAGCAGGTTTAACGACGCTGCC

TATTATTACTGGATGCTGTCCATGCAGTGCCTCGACATGGCTCAAG ATCCTGCCCAGAAGGACGCGATGCTGGACAAGTTTCACCACTTCCAACACCTG

GCTGAGCTGTACCATGGCTATCAAACCATTCACCGATACACG GAGGAGCCATTCAGCTTTGACCTCCCTGAAACCCTCTTCAACATCTCCAAGTTCTTG

CTGCACAGCCTGACCAAGGCCACCCCCTTGGGTATCTCCAAAGT GAATACACTCTTCACACTGGCTAAGCAGAGCAAGGCTCTGGGTGCTTACAAGCTG

GCCCGGCATGCCTATGACAAGCTACGGGGGCTGCAGATCCCCGCCAGGATCCAGAAGTCCATTGAGCTGGGCACCCTGACCATCCGCTCCAAGCCCTTCC

ATGACAGTGAG GAGCTGGTACCCTTGTGCTACCGCTGTTCTACCAACAACCCGCTGCTGAACAACCTTGGCAACGTCTGCATCAACTGCCGCCAGCCCT

TCATCTTCTCCGCCTCTTCCTATG AGGTGCTGCACCTGGTGGAATTCTACCTGGAAGAGGGGATCACTGACGAAGAAGCTGTTGCCCTCATCGATCTGG

AGGCACCAAGACACAAGAGGGAGGGCAAGTGGCGAGAGACCTCAAGCAACA ATTCCCAGACGTTGAAGCTGGACGAGACCATGGACTCCATAGGAGAAG

ATGACCCATTTACAGCCAAGCTGAGCTTTGAG CAAGGTAGCTCTGAGTTTGTGCCTGTGGTGGTGAACCGGTCAGTACTACGCTCCATGAGCCGAAGAG

ATGTTCTCATCAAGCGCTGGCCCCCGCCGCTGCAATGGCAATATTTCCGCTCGCTGTTGCCTGATGCCTCCATCACCATGTGCCCCTCCTGCTTTCAG A

TGTTCCATTCAGAGGACTACGAACTGCTTGTGCTCCAGCACGCCTGCTGCCCTTACTGCCGAAGGCGTATCGACGACACTGGCCCGTGAGCAGCGACAGC

CTCTGGGACCACGGCTCCCATGGTCTCCTTGCTGTCCCCAGACTGTTGGGAGAAGGAATTAAACCCTCAGAACACGTCTCCTGCCCAGATGAAGTTTGTA

TGTTGCAAAGGGGGGGGGGGCTGCCTTGTGTAACCACAGATTTCCTATTTATGGCATTTCATTCCTTGTAAATAGCACCAGGAGACGGGGAAGAGAACAC

ACACATATTTTCTAAGAAAAAAAAAAATCTGTTACTTTTAGAAGGGCTCATGTGTTCATAGCAGCCTGCTGGAGTCCGTAGATCCGTCAGACCATTACCG

TGCACACGTTGCCAACAGATTGCCTCAATAACGACAAATAAAAGGGCTACTCGTTTTCATCAG
Translation
MRAVLTWRDKAEQC - UNI25363 - CIYDLAFKPDGTQLILAAGNRLL VYDTSDGTLLQPLKGHKDTVYCVAYAKDG GKRFASGSADKSIIIWTS

KLEGILKYT THNDSIQCVSYNPVTHQLASCSSSDFG GLWSPEQKSVSKHKSSSKITCCS SWTNDGQYLALGMANGIISIRNKNGEEKVKIERPGGSL

SPIWSICWNPSR REEHNDILAVADWGQKLSFYQLSGKQ IGKDRPLNFDPCCISYFTKGEYILVGGSDKQVSLFTKDGVRLGTVGEQNSWVWTCRVKPD

SNYV VVGCQDGTISFYQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKV VRIKCRELVKKIAIYKNRLAIQLPEKILIYELYSEDSTDMHYRVKEK

IVKKFECNLLVVCADHIILCQ EKRLQCLSFSGVKEREWQMESLIRYIKVIGGPAGREGLLVGLKNGQ ILKIFVDNLFAIVLLKQATAVRCLDMSASRN

KLAVVDENDTCLVYDIHTKELLFQ EPNANSVAWNTQCEDMLCFSGGGYLNIKASTFPVHQQKLQGFVVGYNGSKIFCLHVFSMSAVEVPQ SAPMYQYL

DRKMFKEAYQIACLGVTDADWRELAMEALEGLEFETARK AFTRVQDLRYLELISSIE ERKKRGETNNDLFLADVFSYQGKFHEAAKLYKRSGHENLAL

DMYTDLCMFEYAK DFLGSGDPKETKMLITKQADWARNINEPKAAVEMYISAGEHAKAIEISGSHGWVDM MLIDIARKLDKAEREPLLMCACYFKKLDS

PGYAAETYLKIGDLKSLVQLYVDTKRWDE AFALGEKHPEFKDDVYVPYAQWLAENDRFEEAQKA AFHKAGRQGEAVRVLEQLTHNAVVESRFNDAAYY

YWMLSMQCLDMAQD DPAQKDAMLDKFHHFQHLAELYHGYQTIHRYT EEPFSFDLPETLFNISKFLLHSLTKATPLGISKV VNTLFTLAKQSKALGAY

KLARHAYDKLRGLQIPARIQKSIELGTLTIRSKPFHDSE ELVPLCYRCSTNNPLLNNLGNVCINCRQPFIFSASSYE EVLHLVEFYLEEGITDEEAVA

LIDLEAPRHKREGKWRETSSNN NSQTLKLDETMDSIGEDDPFTAKLSFE QGSSEFVPVVVNRSVLRSMSRRDVLIKRWPPPLQWQYFRSLLPDASITM

CPSCFQ MFHSEDYELLVLQHACCPYCRRRIDDTGP
Transcript ENSMUST00000038234
Sequence
TTGGAGCTTTGGGAAACTCATGCGCGGTTCATTGCGCATGTGCGTTGCTAAGGGTAGCGCAGGTAGCTGAAGTGGTTTGTGGAAAGAAGCCTGTTGCTGC

CGAGGCTGGGAGGAGGGGCCCGAAGCGTGAGGGAAACGGCGATGAGGGCCGTGTTGACGTGGAGAGACAAAGCGGAGCAGTG - UNI25363 - TATC

TACGACCTCGCATTTAAGCCTGATGGAACACAACTGATTCTGGCTGCAGGAAACAGATTGCTG GTTTATGACACCTCTGATGGCACCTTACTTCAGCCC

CTGAAGGGACACAAAGACACCGTGTACTGTGTGGCGTATGCAAAGGATG GCAAGCGCTTTGCATCTGGATCTGCTGACAAGAGCATCATTATCTGGACC

TCAAAACTTGAAGGCATTCTGAAGTACAC GCACAACGACTCTATACAGTGTGTCTCCTACAATCCTGTTACCCACCAGCTGGCATCTTGTTCCTCCAGT

GACTTTG GGTTATGGTCTCCTGAGCAGAAGTCTGTGTCCAAGCACAAATCCAGCAGCAAGATCACGTGCTGCAG CTGGACAAACGATGGTCAGTACCT

GGCTCTGGGCATGGCCAATGGCATCATCAGTATACGGAACAAGAATGGTGAAGAGAAAGTGAAGATCGAGCGCCCTGGGGGCTCCCTCTCCCCAATATGG

TCCATCTGCTGGAACCCTTCAAG AGAGGAACATAATGACATCCTGGCTGTAGCTGACTGGGGACAGAAACTTTCCTTCTACCAGCTGAGTGGAAAACAG

 ATTGGGAAGGATCGGCCACTGAACTTTGACCCCTGTTGCATCAGCTACTTCACTAAAGGAGAGTACATTTTGGTGGGAGGTTCAGACAAGCAGGTATCT

CTTTTCACCAAGGATGGAGTGCGACTGGGGACCGTTGGGGAGCAGAACTCCTGGGTGTGGACCTGTAGAGTGAAACCTGACTCCAATTATGTG GTGGTC

GGCTGCCAGGATGGCACCATCTCCTTCTACCAGCTCATCTTCAGCACAGTCCATGGGCTCTACAAAGATCGGTATGCCTACAGGGACAGCATGACAGACG

TCATCGTGCAGCACCTCATCACAGAGCAGAAAG TTAGGATTAAGTGCAGAGAGCTTGTCAAGAAAATTGCCATCTACAAAAATCGATTAGCTATCCAGC

TGCCAGAGAAGATCCTCATCTACGAGCTGTACTCTGAAGACTCGACAGACATGCACTACCGGGTAAAGGAGAAAATTGTCAAGAAGTTTGAGTGCAACCT

GCTGGTGGTGTGTGCTGACCACATCATCCTGTGCCAG GAGAAACGGCTACAGTGCCTGTCCTTCAGTGGAGTGAAGGAAAGGGAATGGCAGATGGAATC

TCTCATCCGCTACATCAAGGTGATCGGTGGCCCTGCTGGAAGAGAAGGTCTGTTGGTAGGCCTGAAAAACGGCCAG ATCCTGAAGATCTTTGTGGACAA

TCTTTTTGCTATTGTCCTGCTGAAGCAGGCCACAGCCGTGCGCTGCCTGGACATGAGTGCCTCCCGGAACAAGCTGGCTGTGGTGGATGAGAATGACACG

TGCCTGGTGTACGACATCCACACGAAGGAACTGCTTTTCCAG GAACCGAATGCTAACAGCGTGGCCTGGAACACGCAGTGTGAGGACATGCTCTGCTTC

TCTGGAGGAGGCTACCTCAACATCAAGGCCAGCACCTTCCCAGTGCACCAGCAGAAGCTGCAGGGCTTTGTGGTTGGCTACAACGGCTCCAAGATCTTCT

GCCTTCATGTCTTCTCTATGTCTGCCGTGGAGGTGCCACAG TCCGCTCCAATGTACCAGTACCTCGATAGGAAGATGTTCAAAGAAGCATATCAGATCG

CTTGCTTGGGAGTGACAGACGCTGATTGGCGTGAACTGGCCATGGAAGCTCTAGAAGGACTAGAGTTTGAGACGGCAAGGAAG GCCTTCACCAGAGTCC

AGGACCTTCGATACCTAGAACTGATCAGCAGTATTGAG GAGAGGAAGAAGAGGGGAGAGACCAACAATGACCTGTTTCTGGCAGATGTGTTTTCCTACC

AGGGGAAGTTTCATGAAGCCGCCAAACTATACAAGAGGAGCGGGCATGAGAACCTCGCTCTCGACATGTATACTGACCTCTGCATGTTTGAGTACGCCAA

G GATTTCCTTGGATCTGGAGACCCTAAAGAAACGAAGATGCTCATCACCAAGCAGGCCGACTGGGCCAGAAACATCAATGAGCCCAAAGCTGCAGTGGA

GATGTACATCTCAGCAGGGGAGCACGCCAAGGCCATAGAGATCAGCGGCAGCCATGGCTGGGTGGACAT GTTGATAGACATTGCTCGGAAGCTGGACAA

GGCTGAACGGGAGCCCCTGCTCATGTGTGCTTGCTACTTTAAGAAGCTGGACAGTCCTGGCTATGCTGCTGAGACCTACCTGAAGATCGGGGACCTGAAG

TCTCTGGTGCAGCTGTATGTGGACACCAAGCGCTGGGATGAG GCCTTTGCGTTAGGTGAGAAGCACCCGGAGTTCAAGGATGACGTCTACGTGCCCTAC

GCGCAGTGGCTGGCGGAGAACGACCGCTTTGAGGAAGCCCAGAAAG CCTTCCACAAGGCCGGGAGGCAGGGAGAAGCAGTCCGGGTGCTGGAGCAGCTC

ACGCACAATGCTGTGGTGGAGAGCAGGTTTAACGACGCTGCCTATTATTACTGGATGCTGTCCATGCAGTGCCTCGACATGGCTCAAG CAGATCCTGCC

CAGAAGGACGCGATGCTGGACAAGTTTCACCACTTCCAACACCTGGCTGAGCTGTACCATGGCTATCAAACCATTCACCGATACACG GAGGAGCCATTC

AGCTTTGACCTCCCTGAAACCCTCTTCAACATCTCCAAGTTCTTGCTGCACAGCCTGACCAAGGCCACCCCCTTGGGTATCTCCAAAGT GAATACACTC

TTCACACTGGCTAAGCAGAGCAAGGCTCTGGGTGCTTACAAGCTGGCCCGGCATGCCTATGACAAGCTACGGGGGCTGCAGATCCCCGCCAGGATCCAGA

AGTCCATTGAGCTGGGCACCCTGACCATCCGCTCCAAGCCCTTCCATGACAGTGAG GAGCTGGTACCCTTGTGCTACCGCTGTTCTACCAACAACCCGC

TGCTGAACAACCTTGGCAACGTCTGCATCAACTGCCGCCAGCCCTTCATCTTCTCCGCCTCTTCCTATG AGGTGCTGCACCTGGTGGAATTCTACCTGG

AAGAGGGGATCACTGACGAAGAAGCTGTTGCCCTCATCGATCTGGAGGCACCAAGACACAAGAGGGAGGGCAAGTGGCGAGAGACCTCAAGCAACA ATT

CCCAGACGTTGAAGCTGGACGAGACCATGGACTCCATAGGAGAAGATGACCCATTTACAGCCAAGCTGAGCTTTGAG CAAGGTAGCTCTGAGTTTGTGC

CTGTGGTGGTGAACCGGTCAGTACTACGCTCCATGAGCCGAAGAGATGTTCTCATCAAGCGCTGGCCCCCGCCGCTGCAATGGCAATATTTCCGCTCGCT

GTTGCCTGATGCCTCCATCACCATGTGCCCCTCCTGCTTTCAG ATGTTCCATTCAGAGGACTACGAACTGCTTGTGCTCCAGCACGCCTGCTGCCCTTA

CTGCCGAAGGCGTATCGACGACACTGGCCCGTGAGCAGCGACAGCCTCTGGGACCACGGCTCCCATGGTCTCCTTGCTGTCCCCAGACTGTTGGGAGAAG

GAATTAAACCCTCAGAACACGTCTCCTGCCCAGATGAAGTTTGTATGTTGCAAAGGGGGGGGGGGCTGCCTTGTGTAACCACAGATTTCCTATTTATGGC

ATTTCATTCCTTGTAAATAGCACCAGGAGACGGGGAAGAGAACACACACATATTTTCTAAGAAAAAAAAAAATCTGTTACTTTTAGAAGGGCTCATGTGT

TCATAGCAGCCTGCTGGAGTCCGTAGATCCGTCAGACCATTACCGTGCACACGTTGCCAACAGATTGCCTCAATAACGACAAATAAAAGGGCTACTCGT
Translation
MRAVLTWRDKAEQC - UNI25363 - CIYDLAFKPDGTQLILAAGNRLL VYDTSDGTLLQPLKGHKDTVYCVAYAKDG GKRFASGSADKSIIIWTS

KLEGILKYT THNDSIQCVSYNPVTHQLASCSSSDFG GLWSPEQKSVSKHKSSSKITCCS SWTNDGQYLALGMANGIISIRNKNGEEKVKIERPGGSL

SPIWSICWNPSR REEHNDILAVADWGQKLSFYQLSGKQ IGKDRPLNFDPCCISYFTKGEYILVGGSDKQVSLFTKDGVRLGTVGEQNSWVWTCRVKPD

SNYV VVGCQDGTISFYQLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKV VRIKCRELVKKIAIYKNRLAIQLPEKILIYELYSEDSTDMHYRVKEK

IVKKFECNLLVVCADHIILCQ EKRLQCLSFSGVKEREWQMESLIRYIKVIGGPAGREGLLVGLKNGQ ILKIFVDNLFAIVLLKQATAVRCLDMSASRN

KLAVVDENDTCLVYDIHTKELLFQ EPNANSVAWNTQCEDMLCFSGGGYLNIKASTFPVHQQKLQGFVVGYNGSKIFCLHVFSMSAVEVPQ SAPMYQYL

DRKMFKEAYQIACLGVTDADWRELAMEALEGLEFETARK AFTRVQDLRYLELISSIE ERKKRGETNNDLFLADVFSYQGKFHEAAKLYKRSGHENLAL

DMYTDLCMFEYAK DFLGSGDPKETKMLITKQADWARNINEPKAAVEMYISAGEHAKAIEISGSHGWVDM MLIDIARKLDKAEREPLLMCACYFKKLDS

PGYAAETYLKIGDLKSLVQLYVDTKRWDE AFALGEKHPEFKDDVYVPYAQWLAENDRFEEAQKA AFHKAGRQGEAVRVLEQLTHNAVVESRFNDAAYY

YWMLSMQCLDMAQA ADPAQKDAMLDKFHHFQHLAELYHGYQTIHRYT EEPFSFDLPETLFNISKFLLHSLTKATPLGISKV VNTLFTLAKQSKALGA

YKLARHAYDKLRGLQIPARIQKSIELGTLTIRSKPFHDSE ELVPLCYRCSTNNPLLNNLGNVCINCRQPFIFSASSYE EVLHLVEFYLEEGITDEEAV

ALIDLEAPRHKREGKWRETSSNN NSQTLKLDETMDSIGEDDPFTAKLSFE QGSSEFVPVVVNRSVLRSMSRRDVLIKRWPPPLQWQYFRSLLPDASIT

MCPSCFQ MFHSEDYELLVLQHACCPYCRRRIDDTGP

For any suggestions or comments, please send an email to unitrap@crg.es