Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030342 (Cd9)
Chromosomal location
Chr 6: 125410284 - 125444738 (-)
Description
CD9 antigen Gene [Source:MGI (curated);Acc:Cd9-001]
RefSeq_dna
NM_007657 
RefSeq_peptide
NP_031683.1 
UniGene
Mm.210676 Mm.470273 
MGI
MGI:88348 
Uniprot/SWISSPROT
P40240 
Human Ortholog
ENSG00000010278 (CD9)
Omim not available
UniTrap UNI10453
Vector Insertion
Chr 6: 125422530 - 125444591
Public Clones (sanger) G053A05 (ggtc) P085D08 (ggtc) W168F06 (ggtc) E031E11 (ggtc)
D027A04 (ggtc) G068A03 (ggtc) P077A07 (ggtc) D080B10 (ggtc) P125B05 (ggtc)
P063H12 (ggtc) W168E06 (ggtc) P102F01 (ggtc) D065D02 (ggtc) P055B07 (ggtc)
P083E03 (ggtc) E027E11 (ggtc) P071E04 (ggtc) P083A07 (ggtc) G053D05 (ggtc)
P076H05 (ggtc) W168E05 (ggtc) E085H06 (ggtc) D057G05 (ggtc) G086F06 (ggtc)
P077D02 (ggtc) D173A03 (ggtc) P067H12 (ggtc) G002C05 (ggtc) D065D04 (ggtc)
CMHD-GT_260F3-3 (cmhd) FHCRC-GT-S1-9A1 (fhcrc) FHCRC-GT-S21-10B1 (fhcrc) IST10985C2 (tigm)
IST10890H7 (tigm) IST12846E4 (tigm) IST15059F2 (tigm) IST14406A8 (tigm)
IST14222H8 (tigm) IST10467D12 (tigm) IST14877A11 (tigm) IST14168H11 (tigm)
IST10084A6 (tigm) IST10919B6 (tigm) IST14434C3 (tigm) IST14644H10 (tigm)
Private Clones OST238180 (lexicon) OST39160 (lexicon) OST37716 (lexicon) OST37093 (lexicon)
OST36946 (lexicon) OST32499 (lexicon) OST31060 (lexicon) OST30041 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11732
Vector Insertion
Chr 6: 125414506 - 125422426
Public Clones D147C09 (ggtc) G085E08 (ggtc) IST14714F4 (tigm)
Private Clones OST30118 (lexicon)
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11322
Vector Insertion
Chr 6: 125413778 - 125414407
Public Clones G083C02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11992
Vector Insertion
Chr 6: 125412444 - 125413702
Public Clones G063D10 (ggtc)
Private Clones OST454919 (lexicon) OST443930 (lexicon) OST436239 (lexicon) OST436135 (lexicon)
OST434237 (lexicon) OST434134 (lexicon) OST390344 (lexicon) OST377988 (lexicon)
OST375582 (lexicon) OST374310 (lexicon) OST366663 (lexicon) OST345543 (lexicon)
OST301985 (lexicon) OST292093 (lexicon) OST283426 (lexicon) OST274826 (lexicon)
OST255339 (lexicon) OST252413 (lexicon) OST250543 (lexicon) OST240566 (lexicon)
OST238532 (lexicon) OST237851 (lexicon) OST231623 (lexicon) OST230427 (lexicon)
OST230068 (lexicon) OST223147 (lexicon) OST214112 (lexicon) OST211993 (lexicon)
OST210365 (lexicon) OST206726 (lexicon) OST201011 (lexicon) OST197843 (lexicon)
OST196568 (lexicon) OST182199 (lexicon) OST180428 (lexicon) OST173011 (lexicon)
OST172306 (lexicon) OST159569 (lexicon) OST151089 (lexicon) OST141991 (lexicon)
OST138073 (lexicon) OST126314 (lexicon) OST111702 (lexicon) OST109388 (lexicon)
OST106654 (lexicon) OST100524 (lexicon) OST99688 (lexicon) OST77770 (lexicon)
OST68934 (lexicon) OST67409 (lexicon) OST65353 (lexicon) OST51078 (lexicon)
OST45101 (lexicon) OST43975 (lexicon)
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11622
Vector Insertion
Chr 6: 125412222 - 125412344
Public Clones G064D04 (ggtc) P075C11 (ggtc)
Private Clones OST353821 (lexicon) OST196934 (lexicon) OST138586 (lexicon)
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31457
Vector Insertion
Chr 6: 125411243 - 125412222
Public Clones IST13313B3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16367
Vector Insertion
Chr 6: 125410745 - 125411243
Public Clones not available
Private Clones OST462295 (lexicon)
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000032492
Sequence
GCAGCGTGTCTCAGTCGGTTGTCGAGTCCCTTCTGTCCCAGTCGTTCGTGCCTCTTGTCCCACGCAACTCCAGCTTGTACCATGCCGGTCAAAGGAGGTA

GCAAGTGCATCAAATACCTGCTCTTCGGATTTAACTTCATCTTCTGG - UNI10453 - CTCGCTGGCATTGCAGTGCTTGCTATTGGACTATGGCTC

CGATTCGACTCTCAGACCAAGAGCATCTTCGAGCAAGAGAATAACCATTCCAGTTTCTACACAG - UNI11732 - GAGTGTACATTCTGATTGGAGC

CGGGGCCCTCATGATGCTGGTTGGTTTCCTGGGCTGCTGTGGAGCTGTACAAGAGTCCCAGTGCATGCTGGGATTG - UNI11322 - TTCTTCGGGT

TCCTCTTGGTGATATTCGCCATTGAGATAGCCGCCGCCGTCTGGGGCTATACCCACAAGGATGAG - UNI11992 - GTGATTAAAGAACTCCAGGAG

TTTTACAAGGACACCTACCAAAAGTTACGGAGCAAGGATGAACCCCAGCGGGAAACACTCAAAGCCATCCATATGGCG - UNI11622 - - UNI314

57 - TTGGACTGCTGTGGCATAGCTGGTCCTTTGGAGCAGTTTATCTCGGACACCTGCCCCAAGAAACAGCTTTTGGAAAGTTTCCAGGTTAAG - UN

I31457 - CCCTGCCCTGAAGCCATCAGTGAGGTCTTCAACAACAAGTTCCACATCATTGGAGCAGTGGGTATCGGCATCGCCGTGGTGATG - UNI1

6367 - - UNI31457 - ATCTTCGGCATGATCTTCAGCATGATCCTGTGCTGCGCCATCCGCAGGAGCCGAGAAATGGTCTAGAGTCTGCCCAACCC

CGAGCAGGAACAACGGCCCTGAAGACTGTCCGGGCCATTTGGGTTTTTTTTGCCACTAATATTAGTATTCATTATGCATTTCTAAATAACAGTCATTCTG

TTTGTCTTTTTAATGCTTTATTCATTATTGACATTTGTAGTTGAGGGATCCGGGGGTTCAATTTATTTTGATTTTTTTTTTTGGTTGTTTATTTTTGCTT

GTTATGTTAAGCAAAAATCCTGCAATGAAAGGTACTATATTTGCCAGACTCTAGACATAAGATATTGTACATAAAGAGAATTTTTTTTGCCTTTAAATAG

ATAAAAGTATCTATCAGATAAAAATCAGGTTGTAAGTTATATTGAAGACAATTTGATACATAATAAAAGATTATAACAGTG
Translation
MPVKGGSKCIKYLLFGFNFIFW - UNI10453 - LAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTG - UNI11732 - GVYILIGAGALMMLV

GFLGCCGAVQESQCMLGL - UNI11322 - FFGFLLVIFAIEIAAAVWGYTHKDE - UNI11992 - VIKELQEFYKDTYQKLRSKDEPQRETLKA

IHMA - UNI11622 - - UNI31457 - LDCCGIAGPLEQFISDTCPKKQLLESFQVK - UNI31457 - PCPEAISEVFNNKFHIIGAVGIGIA

VVM - UNI16367 - - UNI31457 - IFGMIFSMILCCAIRRSREMV

For any suggestions or comments, please send an email to unitrap@crg.es