Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030346 (Rad51ap1)
Chromosomal location
Chr 6: 126873068 - 126889605 (-)
Description
RAD51 associated protein 1 Gene [Source:MGI (curated);Acc:Rad51ap1-001]
RefSeq_dna
NM_009013 
RefSeq_peptide
NP_033039.2 
UniGene
Mm.406089 Mm.204634 
MGI
MGI:1098224 
Uniprot/SWISSPROT
Q8C551 
Human Ortholog
ENSG00000111247 (RAD51AP1)
Omim not available
UniTrap UNI22141
Vector Insertion
Chr 6: 126886027 - 126889511
Public Clones IST13215D5 (tigm) IST14209C5 (tigm)
Private Clones OST307156 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI263
Vector Insertion
Chr 6: 126884874 - 126885970
Public Clones GC0429 (tigem)
Private Clones OST81090 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12204
Vector Insertion
Chr 6: 126877555 - 126877706
Public Clones A054E05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112220
Sequence
GTCTGGTTTTCGGCGGGAATTGAAACCGCCACAGCTGCTCCCCAGCTCCAGAGCACTGCTGCTCTAGGCAGGGCACCATGGTGCGTCCTATCAG - UNI

22141 - AAATAGAAAACCAATAAATTATTCACAGTTTGAAGATTCTGGCAATGACTCTGATG - UNI263 - ATGATTTTATTTCTTCATCCACAC

CTGTAAACAAGTCAAAAACTGTGCCAAAGGTATTAAAGCAAGACAAACCAAAACCTAACTTGAAGAATCTCCAAAAAGAAGAGGTCTTACCAACAGAACC

CCCTAAAAAAAG GGTGGCTTTAGATGACAAGGTCTTCCAAAGAGGTCTAGAAGTTGCCCTGGCTTTATCTGTGAAGGAACTTCCAACACTCACCAACCA

AGTAAAGAAGTCCAAAGAGAAAA GCACTGACAAACAAGGCAAAGAGAAAACAGAAAATACGGGTAAACCTCCTCATGTCTCTAACTGCAGTGTAGCCAG

TGATGATGTAG - UNI12204 - ATTTGGACAAGATCACAGAGGAGGGGGACGCCTCGAGTGTTGAAGGGGAGAGGAAGTCACCATCTCAAGCCAAGG

CTCCGCGGAGGAGAGCACCTTCTGAAGGCAGCGATGGCAGCAGTGCTAACGACACGGAGTCGGAGAGCGCCACTG - UNI12204 - GTGAAGGTTCA

GAAAGTGATCCTGATTTTGATGAGAGTAAAGAAAGTGATGAAGACTTTGGTGTGAGAAGAAGTAAAGAATCAAAGAAGAAAACAGTGCAGAAGAAACCTG

CAGGGGAAAAGAAGGAAAGGAAATCAAAACCCAAATGTGAGGCATCAG TGACTTCAGTAGACCCAGCTCCAGCTGCCATCAAGTCAGGATCTCCATCTT

TACCCCAGGCAGTTGGTCTTCCTTCTGAGGCCACTAGGAAACCAGCAATAATGTGCAGCCCTTCAGCTGAAAGCAAGAGGCCCAAGTGGGTCCCCCCAG 

CTGCCTCTGGGAGCAGGAACTCTAGCAGCAATGCATTGGCAGGAACACCTGCCAAGTCCCCGAGTCAGAGCCTGCGTCTGGGCCTCTCCCGATTAGCGCC

AGTTAAGCGCTTGCATCCAAGTGCCACAAGCAGCCAAGTGCGGTAGCAGGAAAGGACTGCTGGGACCCTTGGGACTGCAAGCAGGGTTGTCATATTCAGC

TTCCACATAAGAGAACCTTTAATGGGTCACATGAAGGACCATGTCTGTGTGTGATTCTGGTCTCATCAAAGCCTTTCTGTCCTTCAGCAAAGGGTTCTGG

GACCTCTCCTTGTGGCACTCCTGAAGAGTGTGTTGTGTTTTCTTGTGTTTATAAGCCACTGTCACTCGGGCTCTGCGGCACGTCTGTAATCACATGTCTC

CCAGCTCTGGCATGGGAGCATCCTGGGTCCTTCAGGAGGCATTGCTGAAATCTTTCCCATACTACATTTCTTCAGGTTTATTCCAAGCTTACTCTCTTTG

TCTAGGTCTTTTTAGTAAGAATTCTGCTTTTGTACATATTAACATGTTGACTCTACTGCAGCATGTGTTCCTACATGGGACAGGTGGTTAGTGTACAGCA

GATAGAATCTCATGACGCTGTATGAACTTTTCAAAACCTTTAATAAACATGAAAAGATGTAAGCTATGCTCATTGATACCATGTATGTACCTGCATGTGT

ACGTGTTGCTAAAATGAGTCTTCTGTGGTCAAAATAAGCAGGGGGAGGAGTGTCTTCATCATTGAGATGAAGCCCAAGGTTGAAAGCTGTCACCTCCACG

CCCCTGTCACAGCTGATGCATCGTCTCAGGAAGCTCTGGTTTACTGTCAGTAAAAGCAATTATTTTTATAGTAAGAAATCAACTTGTTTCTGATTACTTT

AATAAAGTCTAATGTTTACTGTAAAATGTGCATGCCTCGCCTAGTTCTCAGCTATGAGACATCTGTGTTACCGTGAGGACAAGCAGCTTTGATTTAAGTG

ACCATTGCTTTTGTACATCTTCTTACTCATATATATGCTTACACTGTATTCTCCACCTTACCTGCTCCACCGTCCTTAAAATCCCAATCTTCAGTTAGCA

ATCTGCGTGATTTTGGTTCTGATTTTTGAGACAGGGCTTCCTATGTAGCCCAGGCTGTCCTTGAACCTACCATCCTTCCTTCTGCCACGGCCTCCCTAGT

GGTGGTGGGTGCTGTGACACCCACCTAGTTACCTGGTTTTGAGTTAATTTGTATGCTTTGAGCAATAACCATTGTTATAAATATATAATAC
Translation
MVRPIR - UNI22141 - RNRKPINYSQFEDSGNDSDD - UNI263 - DDFISSSTPVNKSKTVPKVLKQDKPKPNLKNLQKEEVLPTEPPKKR R

VALDDKVFQRGLEVALALSVKELPTLTNQVKKSKEKS STDKQGKEKTENTGKPPHVSNCSVASDDVD - UNI12204 - DLDKITEEGDASSVEGER

KSPSQAKAPRRRAPSEGSDGSSANDTESESATG - UNI12204 - GEGSESDPDFDESKESDEDFGVRRSKESKKKTVQKKPAGEKKERKSKPKCEAS

V VTSVDPAPAAIKSGSPSLPQAVGLPSEATRKPAIMCSPSAESKRPKWVPPA AASGSRNSSSNALAGTPAKSPSQSLRLGLSRLAPVKRLHPSATSSQ

VR
Transcript ENSMUST00000112221
Sequence
GTCTGGTTTTCGGCGGGAATTGAAACCGCCACAGCTGCTCCCCAGCTCCAGAGCACTGCTGCTCTAGGCAGGGCACCATGGTGCGTCCTATCAG - UNI

22141 - AAATAGAAAACCAATAAATTATTCACAGTTTGAAGATTCTGGCAATGACTCTGATG - UNI263 - ATGATTTTATTTCTTCATCCACAC

CTGTAAACAAGTCAAAAACTGTGCCAAAGGTATTAAAGCAAGACAAACCAAAACCTAACTTGAAGAATCTCCAAAAAGAAGAGGTCTTACCAACAGAACC

CCCTAAAAAAAG GGTGGCTTTAGATGACAAGGTCTTCCAAAGAGGTCTAGAAGTTGCCCTGGCTTTATCTGTGAAGGAACTTCCAACACTCACCAACCA

AGTAAAGAAGTCCAAAGAGAAAA GCACTGACAAACAAGGCAAAGAGAAAACAGAAAATACGGGTAAACCTCCTCATGTCTCTAACTGCAGTGTAGCCAG

TGATGATGTAG AAGATTTGGACAAGATCACAGAGGAGGGGGACGCCTCGAGTGTTGAAGGGGAGAGGAAGTCACCATCTCAAGCCAAGGCTCCGCGGAG

GAGAGCACCTTCTGAAGGCAGCGATGGCAGCAGTGCTAACGACACGGAGTCGGAGAGCGCCACTG - UNI12204 - GTGAAGGTTCAGAAAGTGATC

CTGATTTTGATGAGAGTAAAGAAAGTGATGAAGACTTTGGTGTGAGAAGAAGTAAAGAATCAAAGAAGAAAACAGTGCAGAAGAAACCTGCAGGGGAAAA

GAAGGAAAGGAAATCAAAACCCAAATGTGAGGCATCAG TGACTTCAGTAGACCCAGCTCCAGCTGCCATCAAGTCAGGATCTCCATCTTTACCCCAGGC

AGTTGGTCTTCCTTCTGAGGCCACTAGGAAACCAGCAATAATGTGCAGCCCTTCAGCTGAAAGCAAGAGGCCCAAGTGGGTCCCCCCAG CTGCCTCTGG

GAGCAGGAACTCTAGCAGCAATGCATTGGCAGGAACACCTGCCAAGTCCCCGAGTCAGAGCCTGCGTCTGGGCCTCTCCCGATTAGCGCCAGTTAAGCGC

TTGCATCCAAGTGCCACAAGCAGCCAAGTGCGGTAGCAGGAAAGGACTGCTGGGACCCTTGGGACTGCAAGCAGGGTTGTCATATTCAGCTTCCACATAA

GAGAACCTTTAATGGGTCACATGAAGGACCATGTCTGTGTGTGATTCTGGTCTCATCAAAGCCTTTCTGTCCTTCAGCAAAGGGTTCTGGGACCTCTCCT

TGTGGCACTCCTGAAGAGTGTGTTGTGTTTTCTTGTGTTTATAAGCCACTGTCACTCGGGCTCTGCGGCACGTCTGTAATCACATGTCTCCCAGCTCTGG

CATGGGAGCATCCTGGGTCCTTCAGGAGGCATTGCTGAAATCTTTCCCATACTACATTTCTTCAGGTTTATTCCAAGCTTACTCTCTTTGTCTAGGTCTT

TTTAGTAAGAATTCTGCTTTTGTACATATTAACATGTTGACTCTACTGCAGCATGTGTTCCTACATGGGACAGGTGGTTAGTGTACAGCAGATAGAATCT

CATGACGCTGTATGAACTTTTCAAAACCTTTAATAAACATGAAAAGATGTAAGCTATGCTCATTGATACCATGTATGTACCTGCATGTGTACGTGTTGCT

AAAATGAGTCTTCTGTGGTCAAAATAAGCAGGGGGAGGAGTGTCTTCATCATTGAGATGAAGCCCAAGGTTGAAAGCTGTCACCTCCACGCCCCTGTCAC

AGCTGATGCATCGTCTCAGGAAGCTCTGGTTTACTGTCAGTAAAAGCAATTATTTTTATAGTAAGAAATCAACTTGTTTCTGATTACTTTAATAAAGTCT

AATGTTTACTGTAAAATGTGCATGCCTCGCCTAGTTCTCAGCTATGAGACATCTGTGTTACCGTGAGGACAAGCAGCTTTGATTTAAGTGACCATTGCTT

TTGTACATCTTCTTACTCATATATATGCTTACACTGTATTCTCCACCTTACCTGCTCCACCGTCCTTAAAATCCCAATCTTCAGTTAGCAATCTGCGTGA

TTTTGGTTCTGATTTTTGAGACAGGGCTTCCTATGTAGCCCAGGCTGTCCTTGAACCTACCATCCTTCCTTCTGCCACGGCCTCCCTAGTGGTGGTGGGT

GCTGTGACACCCACCTAGTTACCTGGTTTTGAGTTAATTTGTATGCTTTGAGCAATAACCATTGTTATAAATATATAATAC
Translation
MVRPIR - UNI22141 - RNRKPINYSQFEDSGNDSDD - UNI263 - DDFISSSTPVNKSKTVPKVLKQDKPKPNLKNLQKEEVLPTEPPKKR R

VALDDKVFQRGLEVALALSVKELPTLTNQVKKSKEKS STDKQGKEKTENTGKPPHVSNCSVASDDVE EDLDKITEEGDASSVEGERKSPSQAKAPRRR

APSEGSDGSSANDTESESATG - UNI12204 - GEGSESDPDFDESKESDEDFGVRRSKESKKKTVQKKPAGEKKERKSKPKCEASV VTSVDPAPAA

IKSGSPSLPQAVGLPSEATRKPAIMCSPSAESKRPKWVPPA AASGSRNSSSNALAGTPAKSPSQSLRLGLSRLAPVKRLHPSATSSQVR
Transcript ENSMUST00000032496
Sequence
AGCTGCTCCCCAGCTCCAGAGCACTGCTGCTCTAGGCAGGGCACCATGGTGCGTCCTATCAG - UNI22141 - AAATAGAAAACCAATAAATTATTC

ACAGTTTGAAGATTCTGGCAATGACTCTGATG - UNI263 - AAATAGATGATTTTATTTCTTCATCCACACCTGTAAACAAGTCAAAAACTGTGCCA

AAGGTATTAAAGCAAGACAAACCAAAACCTAACTTGAAGAATCTCCAAAAAGAAGAGGTCTTACCAACAGAACCCCCTAAAAAAAG GGTGGCTTTAGAT

GACAAGGTCTTCCAAAGAGGTCTAGAAGTTGCCCTGGCTTTATCTGTGAAGGAACTTCCAACACTCACCAACCAAGTAAAGAAGTCCAAAGAGAAAA GC

ACTGACAAACAAGGCAAAGAGAAAACAGAAAATACGGGTAAACCTCCTCATGTCTCTAACTGCAGTGTAGCCAGTGATGATGTAG AAGATTTGGACAAG

ATCACAGAGGAGGGGGACGCCTCGAGTGTTGAAGGGGAGAGGAAGTCACCATCTCAAGCCAAGGCTCCGCGGAGGAGAGCACCTTCTGAAGGCAGCGATG

GCAGCAGTGCTAACGACACGGAGTCGGAGAGCGCCACTG - UNI12204 - GTGAAGGTTCAGAAAGTGATCCTGATTTTGATGAGAGTAAAGAAAGT

GATGAAGACTTTGGTGTGAGAAGAAGTAAAGAATCAAAGAAGAAAACAGTGCAGAAGAAACCTGCAGGGGAAAAGAAGGAAAGGAAATCAAAACCCAAAT

GTGAGGCATCAG TGACTTCAGTAGACCCAGCTCCAGCTGCCATCAAGTCAGGATCTCCATCTTTACCCCAGGCAGTTGGTCTTCCTTCTGAGGCCACTA

GGAAACCAGCAATAATGTGCAGCCCTTCAGCTGAAAGCAAGAGGCCCAAGTGGGTCCCCCCAG CTGCCTCTGGGAGCAGGAACTCTAGCAGCAATGCAT

TGGCAGGAACACCTGCCAAGTCCCCGAGTCAGAGCCTGCGTCTGGGCCTCTCCCGATTAGCGCCAGTTAAGCGCTTGCATCCAAGTGCCACAAGCAGCCA

AGTGCGGTAGCAGGAAAGGACTGCTGGGACCCTTGGGACTGCAAGCAGGGTTGTCATATTCAGCTTCCACATAAGAGAACCTTTAATGGGTCACATGAAG

GACCATGTCTGTGTGTGATTCTGGTCTCATCAAAGCCTTTCTGTCCTTCAGCAAAGGGTTCTGGGACCTCTCCTTGTGGCACTCCTGAAGAGTGTGTTGT

GTTTTCTTGTGTTTATAAGCCACTGTCACTCGGGCTCTGCGGCACGTCTGTAATCACATGTCTCCCAGCTCTGGCATGGGAGCATCCTGGGTCCTTCAGG

AGGCATTGCTGAAATCTTTCCCATACTACATTTCTTCAGGTTTATTCCAAGCTTACTCTCTTTGTCTAGGTCTTTTTAGTAAGAATTCTGCTTTTGTACA

TATTAACATGTTGACTCTACTGCAGCATGTGTTCCTACATGGGACAGGTGGTTAGTGTACAGCAGATAGAATCTCATGACGCTGTATGAACTTTTCAAAA

CCTTTAATAAACATGAAAAGATGTAAGCTATGCTCATTGATACCATGTATGTACCTGCATGTGTACGTGTTGCTAAAATGAGTCTTCTGTGGTCAAAATA

AGCAGGGGGAGGAGTGTCTTCATCATTGAGATGAAGCCCAAGGTTGAAAGCTGTCACCTCCACGCCCCTGTCACAGCTGATGCATCGTCTCAGGAAGCTC

TGGTTTACTGTCAGTAAAAGCAATTATTTTTATAGTAAGAAATCAACTTGTTTCTGATTACTTTAATAAAGTCTAATGTTTACTGT
Translation
MVRPIR - UNI22141 - RNRKPINYSQFEDSGNDSDE - UNI263 - EIDDFISSSTPVNKSKTVPKVLKQDKPKPNLKNLQKEEVLPTEPPKKR

 RVALDDKVFQRGLEVALALSVKELPTLTNQVKKSKEKS STDKQGKEKTENTGKPPHVSNCSVASDDVE EDLDKITEEGDASSVEGERKSPSQAKAPR

RRAPSEGSDGSSANDTESESATG - UNI12204 - GEGSESDPDFDESKESDEDFGVRRSKESKKKTVQKKPAGEKKERKSKPKCEASV VTSVDPAP

AAIKSGSPSLPQAVGLPSEATRKPAIMCSPSAESKRPKWVPPA AASGSRNSSSNALAGTPAKSPSQSLRLGLSRLAPVKRLHPSATSSQVR

For any suggestions or comments, please send an email to unitrap@crg.es