Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030347 (D6Wsu163e)
Chromosomal location
Chr 6: 126889984 - 126925722 (+)
Description
Uncharacterized protein C12orf4 homolog  [Source:UniProtKB/Swiss-Prot;Acc:Q91YN0]
RefSeq_dna
NM_138594 
RefSeq_peptide
NP_613060.1 
UniGene
Mm.44228 Mm.413441 
MGI
MGI:107893 
Uniprot/SWISSPROT
Q91YN0 
Uniprot/SPTREMBL
Q9CRN9 
Human Ortholog
ENSG00000047621 (AC008012.8)
Omim not available
UniTrap UNI453
Vector Insertion
Chr 6: 126892525 - 126894809
Public Clones DC0117 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000032497
Sequence
GACTTATTTGGGCAGTTCTGCGTTGACAGCTCCAAGTGTGCTTTGGTGTCTGATGAGAGAG AAACCCTGCTGAAGAATATGAAGAAAAACCGAGAAAGG

TTCTGCAACAAGGAAAGGGAATTTGTGTACAAGTTCCAGGTAGGACGTGAGCGCTTAGAGCTGAGAGTGCCCCTCAGGTTTCCTGTGGAGGAGAATGCCA

GTCATCTGCATGGACGTCTGATGCTGCTGCACAGCTTGCCTTGCTTCATAGAGAGTG - UNI453 - ACTTAAAAGATGCTCTGAGCCGGTTTATAGA

AGAAGAATCCCTCAGAGACCATGACAGCGATGCAGAAGCATGCTTGGAGGCCGTTAAATCCGGTGAAGTAGATCTGCACCAGCTGGCAAGTGCGTGGGCC

AAAGCTTACGCTGAG ACCACCTTAGAGCATGCGAGACCTGAGGAGCCTGACTGGGACGAAGACTTTGCAGATGTGTACCATGACCTAATCCACTCCCCG

GCCTCTGAAACTCTCTTAAATCTGGAACACAACTACTTCGTTAGCATCTCAGAGCTGATTGGTGAAAGAGACGTGGAGCTGAAAAAGTTACGAGAGAG A

CAAGGTATTGAAATGGAAAAGGTGATGCAGGAGCTGGGGAAATCGCTCACAGATCAAGATGTGAATTCACTGGCTGCCCAGCACTTTGAATCCCAGCAA 

GACTTAGAGAATAAATGGTCAAATGAACTGAAACAGTCTACAGCTATCCAGAAGCAAGAATATCAGGAATGGGTGATAAAGCTTCATCAGGACCTAAAAA

ACCCCAACAACAGCTCCCTCAG TGAAGAGATTAAAGTGCAGCCGAGTCAGTTCAGAGAGTCTGCGGACGCTGCTGGGAGGATCTACGAGGAACAGAGGA

AGCTGGAGGAGAGCTTCACCATTCACCTGG GAGCCCAGTTGAAGACCATGCACAACCTGCGGCTGCTGAGGGCAGACATGCTGGACTTCTGTAAGCATA

AGAGAACTCACGGGAGCGGCGTGAAGCTCCACCGTCTGCAGACAGCACTGTCCCTCTACTCCACGTCTCTCTGTGGCCTGGTTTTGCTAGTAGATAATCG

AATTAATTCATATAGCGGCATCAAAAGAG ATTTTGCCACAGTTTGCCAAGAATGTACGGACTTCCACTTCCCACGGATTGAGGAACAACTGGAAGTTGT

CCAGCAGGTGGCGCTGTACGCGAGAACCCAACGCAAGAGCAAGTGCAAAGAGGCCCGCG ATTCTGGAAACCAAAATGGAGGAAGTGATGATAAGTCTAA

GAATGCTGAGAGAAACTATTTAAATATTTTACCTG GAGAATTTTACATTACACGTCATTCTAATCTCTCGGAAATCCATGTTGCTTTCCACCTCTGTGT

GGATGATAACGTGAAGTCGGGAAATATCACTGCTCGGGATCCCGCTATTATGGGACTCCGAAACATTCTCAAAGTCTGCTGTACCCATGATATCACAACG

ATAAGCATCCCTCTCTTGCTGGTGCATGATATGTCAGAG GAAATGACTATACCTTGGTGTTTAAGGAGAGCAGAACTGGTATTTAAGTGTGTCAAAG G

TTTCATGATGGAGATGGCTTCATGGGACGGAGGAATTTCTCGGACAGTGCAATTTCTGGTACCACAG AGCATTTCTGAAGAAATGTTTTATCAGCTGAG

CAACATGCTTCCCCAGATCTTCCGGGTCTCCTCAACACTCACGCTGACATCCAAGCACTAACTCATAGACGGACACACTGACAGAAGAGGATTTCTGAAC

TCTCTGAGAGAACTGTCCTGGAATCCTGTTAAGCAAAAGGTGCCCAGTGGGATCGAGCCACCTGTTAAGTGATGAAGTATGTTATCAAACATTCCAAAAA

TGTGTACACGTCACAGACCAGAAGCCAGCTCCCAACTGAAGCATTTACTCAGTCCCTTTATGAAATAATAGCTCTTCTTTCTACTTATATGTCCTATCAG

GGAATGATGGTGGTAACACTTGAGGTGTCTCTCAAATATGGACACTGTATTTCGTTGCACTTCCGTGGAGACCTCTGATTTTTCCGTGGCATGAGTTCTG

TAATTAGGCATAAAAGTACAATTTTTCCTTTTACTTTATTTGTTAAATCAAGATTTAAATATACATTTCAAGTATAAATTTCATGTGAAAATGTTTTTGT

AGCAATGCAAGTATACCAGACAAATGTGCTTGTTGTTTTAAATTCTCCTGTTTCAAACCCTG
Translation
 MKKNRERFCNKEREFVYKFQVGRERLELRVPLRFPVEENASHLHGRLMLLHSLPCFIESD - UNI453 - DLKDALSRFIEEESLRDHDSDAEACLE

AVKSGEVDLHQLASAWAKAYAE TTLEHARPEEPDWDEDFADVYHDLIHSPASETLLNLEHNYFVSISELIGERDVELKKLRER RQGIEMEKVMQELGK

SLTDQDVNSLAAQHFESQQ DLENKWSNELKQSTAIQKQEYQEWVIKLHQDLKNPNNSSLS SEEIKVQPSQFRESADAAGRIYEEQRKLEESFTIHLG 

GAQLKTMHNLRLLRADMLDFCKHKRTHGSGVKLHRLQTALSLYSTSLCGLVLLVDNRINSYSGIKRD DFATVCQECTDFHFPRIEEQLEVVQQVALYAR

TQRKSKCKEARD DSGNQNGGSDDKSKNAERNYLNILPG GEFYITRHSNLSEIHVAFHLCVDDNVKSGNITARDPAIMGLRNILKVCCTHDITTISIPL

LLVHDMSE EMTIPWCLRRAELVFKCVKG GFMMEMASWDGGISRTVQFLVPQ SISEEMFYQLSNMLPQIFRVSSTLTLTSKH

For any suggestions or comments, please send an email to unitrap@crg.es