Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030357 (Fkbp4)
Chromosomal location
Chr 6: 128380125 - 128388649 (-)
Description
FK506 binding protein 4 Gene [Source:MGI (curated);Acc:Fkbp4-001]
RefSeq_dna
NM_010219 
RefSeq_peptide
NP_034349.1 
UniGene
Mm.12758 
MGI
MGI:95543 
Uniprot/SWISSPROT
P30416 
Uniprot/SPTREMBL
Q8CBS1 
Human Ortholog
ENSG00000004478 (FKBP4)
Omim not available
UniTrap UNI29898
Vector Insertion
Chr 6: 128386587 - 128388650
Public Clones E026C05 (ggtc) E030C05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9621
Vector Insertion
Chr 6: 128385875 - 128386587
Public Clones RRB169 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37532
Vector Insertion
Chr 6: 128383812 - 128384322
Public Clones Ayu21-W74 (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20569
Vector Insertion
Chr 6: 128382680 - 128383123
Public Clones not available
Private Clones OST358485 (lexicon)
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11850
Vector Insertion
Chr 6: 128380899 - 128382439
Public Clones A071F02 (ggtc) PST18312-NR (escells) PST9298-NL (escells) PST18300-NR (escells)
IST10880F4 (tigm)
Private Clones OST436206 (lexicon)
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000032508
Sequence
GGTTCGAGGTGGGCAGCGCCGCCTTCCGCCGCACGCCGCCCCGTCGCTCACTCCGGTCGGCGGCCAGAGTGCCGTGCTCGCGCTTGCCACACTCTCGCAG

CCAACGGTGCGCCCAGCGGCCATGACCGCCGAGGAGATGAAGGCGGCGGAGAACGGGGCGCAGTCGGCGCCCCTGCCTCTCGAAGGAGTGGACATCAGCC

CCAAACAGGACGAGGGCGTGCTCAAG - UNI29898 - GTCATCAAGAGAGAGGGTACAGGCACAGAGACACCCATGATCGGGGACCGAGTCTTTGTC

CACTACACTGGCTGGCTGCTAGATGGCACAAAGTTTGACTCCAGTCTGGACCGCAAGGACAAATTCTCCTTTGACCTGGGAAAAG - UNI9621 - - 

UNI29898 - GGGAGGTCATCAAGGCTTGGGATATTGCTGTGGCAACCATGAAAGTGGGGGAAGTGTGCCACATCACCTGCAAGCCAGAATATGCCTAT

GGCGCAGCAGGCAGCCCTCCGAAGATCCCCCCCAACGCCACACTTGTATTTGAG GTGGAGCTGTTTGAGTTCAAAGGAGAAGATCTTACAGAAGAAGAA

GATGGCGGGATCATCCGCAGAATACGGACTCGGGGTGAAGGCTATGCCAGGCCCAATGATGGTGCTATGGTGGAAG TGGCCCTGGAAGGCTACCACAAG

GACCGCCTCTTTGACCAGCGGGAGCTCTGCTTTGAAGTCGGGGAAGGGGAAAGTCTAGATCTGCCCTGTGGGCTGGAGGAGGCCATTCAGCGCATGGAGA

AAGGAGAGCATTCCATCGTGTACCTCAAACCTAG CTATGCTTTTGGCAGTGTGGGGAAGGAGAGGTTCCAGATCCCACCGCACGCTGAGCTGAGGTATG

AAGTGCGGCTGAAGAGCTTTGAGAAG GCCAAGGAGTCTTGGGAGATGAGCTCCGCGGAGAAGCTGGAGCAGAGCAACATAGTGAAAGAGAGGGGCACCG

CGTACTTCAAG GAAGGCAAGTACAAGCAGGCGTTACTGCAGTACAAGAAGATCGTGTCTTGGCTAGAATACGAGTCTAGCTTCTCCGGTGAGGAAATGC

AAAAGGTCCATGCACTCCGACTGGCCTCACACCTCAATCTGGCCATGTGTCACCTGAAACTGCAGGCCTTCTCAGCTGCCATCGAAAGCTGCAACAAG -

 UNI20569 - GCCTTGGAGCTGGACAGCAACAACGAGAAGGGCCTGTTTCGCCGGGGAGAGGCCCACCTGGCCGTGAATGACTTTGACCTGGCAAGAG

CTGACTTCCAAAAGGTCCTGCAGCTCTATCCCAGCAACAAAGCCGCCAAGACCCAGCTGGCTGTGTGCCAGCAGCGGACCCGTAGGCAGCTCGCCCGGGA

AAAGAAGCTCTATGCCAACATGTTTGAGAGGCTGGCTGAGGAGGAGCACAAG - UNI11850 - GTGAAGGCAGAAGTGGCAGCAGGAGACCATCCCA

CTGATGCTGAGATGAAGGGTGAGCGGAACAATGTGGCCGAGAACCAGTCTCGGGTGGAGACAGAAGCGTAGCCTGCCTCTTCCGCTGCCCACCTCTGCAG

CTGCTCCCTGCTCCCTTCTTACTCCACCCTGTTAGTTTTGTAAAAACTGAAGAATTTTGAGTGAATTAGACCTTTATTTTTCTATCTGTTTGGATGATGG

CTTTGGGGGAGAAGGGAGAAGAGAAGGCTGAGGGTGAAATGGGGGGTAGTTTTAGATGGTGTCAACCCTACTTTTCTTCCCCCGTTACACACAAGTGTAT

ATCCTTTCACACGTACATCAGAATGTTAATTTATTTTGCTCCCTCTGTTAGCTCCATTTTCACGTGGTAGAAGGGGGGACGTGATAGGGATGGGGTCTGA

TAAGCCAGGGTGGAGAAGAAAACTCCTGGACAGCCATTTTCCCATCTCTTCCCTCTGTGGTTTTCCAAGCCTGTGTCTCCGTGCAGGTGCTAGGGGCATG

GGTACACCGCTGTTGCATCCATTGCCTCTCTTACCTTGCTCTCCTGAGTTGGTATTCCTGATAACGCCCTCTGGTATCACAGTGATCACCTCTAGACAGC

CCCTACCAGTACCTCCGCTCCTCTCAGTTTCCTCATCCAGGTTGTCCCTGTCCTGTCCCTATCCCCTCAGCCTCTTTAATGCACGCTGAAGGTCCAGGCA

CACCTCAAGTCCTGTGCTTGAGCAATAAAGTGGAAACAAC
Translation
MTAEEMKAAENGAQSAPLPLEGVDISPKQDEGVLK - UNI29898 - VIKREGTGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKG -

 UNI9621 - - UNI29898 - GEVIKAWDIAVATMKVGEVCHITCKPEYAYGAAGSPPKIPPNATLVFE VELFEFKGEDLTEEEDGGIIRRIRTRG

EGYARPNDGAMVEV VALEGYHKDRLFDQRELCFEVGEGESLDLPCGLEEAIQRMEKGEHSIVYLKPS SYAFGSVGKERFQIPPHAELRYEVRLKSFEK

 AKESWEMSSAEKLEQSNIVKERGTAYFK EGKYKQALLQYKKIVSWLEYESSFSGEEMQKVHALRLASHLNLAMCHLKLQAFSAAIESCNK - UNI20

569 - ALELDSNNEKGLFRRGEAHLAVNDFDLARADFQKVLQLYPSNKAAKTQLAVCQQRTRRQLAREKKLYANMFERLAEEEHK - UNI11850 - 

VKAEVAAGDHPTDAEMKGERNNVAENQSRVETEA

For any suggestions or comments, please send an email to unitrap@crg.es