Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030428 (Ttyh1)
Chromosomal location
Chr 7: 4071132 - 4086947 (+)
Description
tweety homolog 1 (Drosophila) Gene [Source:MGI (curated);Acc:Ttyh1-005]
RefSeq_dna
NM_021324 
RefSeq_peptide
NP_001103235.1 NP_067299.2 NP_001001454.2 
UniGene
Mm.474056 Mm.29729 
MGI
MGI:1889007 
Uniprot/SWISSPROT
Q9D3A9 
Human Ortholog
ENSG00000167614 (TTYH1)
Omim not available
UniTrap UNI31852
Vector Insertion
Chr 7: 4074258 - 4076105
Public Clones IST13102F2 (tigm) IST12407H9 (tigm) IST13579D12 (tigm) IST11030A1 (tigm)
IST12716G11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24162
Vector Insertion
Chr 7: 4076334 - 4077124
Public Clones IST12353G11 (tigm)
Private Clones OST232532 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108591
Sequence
ATGCAGAGATCAGATAG TGCCGGCATTGGCATTGGTTTCTATGGTAACAGCGAGACCAGCGATGGGGTGTCCCAGCTCAGCTCAGCACTGCTGCACGCC

AACCACACGCTCAGCACCATCGATGACGTG - UNI24162 - GTGCTGGAAACGGTGGAGAGGCTGGGTGAGGCAGTGAAGACGGAGCTGACCACCCT

GGAGGAAGTGCTGTCAGTCCGCATGGAGCTGGTGGCTGCCACCAGGGGAGCCCGAAGGCAGGCTGAAGCTGCTGCTCAGTACCTGCAAGGACTGGCCTTC

TGGCAAGGAGTGTCCCTGAGCCCCGTACAGGTGGCTGAAGATGTGACTTTCGTGGAGGAGTACAG GTGGCTGGCCTATGTCCTCCTGCTGCTCTTGGTG

CTTCTGGTTTGTCTCTTCACCCTCCTGGGCCTGGCAAAGCAGAGCAAATGGCTGGTGGTTGT GATGACTGCCATGAGTCTCCTGGTGCTTGTCCTGAGC

TGGGGTTCTATGGGCCTAGAGGCTGCCACAGCTGTG GGCCTCAGTGACTTCTGCTCCAACCCAGACACCTATGTGCTGAACCTGACCCAGGAGGAGACA

GGGCTCAGCTCAG ACATCCTCAGCTATTATTTCCTGTGCAACCAGGCGGTCTCCAACCCCTTCCAACAG AGGCTGACGCTGTCCCAGCGTGCTCTAGC

CAGCATCCACTCTCAGCTGCAGGGCCTGGAGCGGGAAGCTATCCCTCAATTTTCTGCTGCACAG AAGCCCTTGTTATCCTTGGAGGAGACACTGAATGT

GACAGAAAGAAGCTTCCACCAGTTGGTGGCGCTGCTGCACTGCCGCAGTCTGCACAAG GACTATGGCTCAGCACTCCGAGGCCTGTGTGAAGATGCCCT

AGAGGGCCTACTGTTCCTGATGCTCTTTTCTCTCCTGTCTGCGGGGGCCCTAGCCACCACTCTGTGCAGCCTGCCCCGCGCCTGGGCCCTCTTCCCACCC

AG TGATGACTACGATGACACAGATGACGATGACCCTTTCAACCCTCAG GAATCCAAACGCTTTGTGCAGTGGCAGTCTTCCATCTGAGCCTCCCCTCC

AGTCTGGAGCCTGCCTCTCCTCTATG CTCCTTTCCTGGCTGCTGGAGAAGGCCCCACTAACCTGACCTTGACTGGGCTCTGACCACTAACACTGCTGGC

TATGGACATCTCACTTAGGATGGCAACCTGCTCTGGCCCTAACACCCACCCCCCCATCCCCATTTCTCCTTAGCACAGGGGATTGCTGAGGTGGCACAAC

AGGGACCAGGGGTGGCTGGGAAGGGGGCTGACCTATACAGCCTGGTGTTCCTCACCTCTGGCTGCCAGTCCTGTCCTTGGAGGGATGAAGCTGGAGGCAG

GTACAGGCACGTCCCTGTTTCCTGCCATACCCCAGCGATCTCAACCTATGGCACTAACTTGGAAGAGGGCTGATTTGAAATAAAAGGGAAGGCTTTATTT

TACAAGCAGCTAGGTCCTTCTTATCCACCCCAACTACTGAGAGAAGGAAGTCCTGACTGGGCTAGGGACACTCCTCCTCTGGTGGTTGAAAGGCAACTCT

CCTCTTGTCCAGGCTCAGCACTGCATTGCTTCTATAAGTAACATGTGAATCCTGACAAGGGGGAAGAAGCAGATACCGGAAGAGAATAAGCCTAGCACTA

AATCTAAACAGGCGTGCAGCCACAGGAACAGTCAAGCTTCCAGTCCCGTGGAATGTACAAAGCCTGCTGGGTTTAGGAAAGGCGTGGAATCAACTTGCTT

CCTAGCAGCTCACACCCAGCACAAGACTCCAGAAAACCAACGCTTGTATCAGAATAGGGACAGAAGTCTTCGAAGAGAAAGTAGAATATTTGCTTGTAGT

GCCACCAGGGTGATATGAAGGGGGAAGGTTTAAGGAAGATATTATAAATCCAGGCAGGAAAAGATGAGGCACTCAATAAGTTATCAAGTAAAAACAAACA

TGGCAGAGTCAAAAGGGAAATTTATTGTCTGGGGAACAATATGTATGTAGTTCTCATTTGTTTAAAAAACAAATAGCATACATGGCAAAGAAAAACGTGG

TTAATACATAAACATAATTCAAAAAGCTTCTATTATCTAACAAAAAAGACCTCAATTTAATAATAAGTAACTGAGAAAAACAAAAACCCCAAAACAAATG

GATAAAATTGTCTTTTTTGTCTTTGTTGTTGTTGTTTTGGAGACAGGGTTTCTCTGTGAAACAGCCCTGGGCTGTCCTGGAACTCTCTTTGTAGACCAGG

CTGGCCTTGAACTCACAGAGAAGAGCCTGCCTCAGCCTCTGCCTCCCTAGTGAGGAGATTAACGGCGTGTGACGGCGTGTATCACCACACCCAACTAAAG

TGTTCAAATTCTAATGATTAGCAAACACAATGTGCTACTTTCCCCTTTCGAGTACCTATTTGTTGTGGGATTTAGAGTGGAGTGTGGGCTGGTGCTGGTC

TGGAGGCCCAGGGAACAGGTTCTCTAAATATGCTGCCCAGAGACTGTGAATCACCAGCTATGTGAAAATAATAATAAACAAAACAAATAAACAAACATAA

ATATGCT
Translation
MQRSDS SAGIGIGFYGNSETSDGVSQLSSALLHANHTLSTIDDV - UNI24162 - VLETVERLGEAVKTELTTLEEVLSVRMELVAATRGARRQAE

AAAQYLQGLAFWQGVSLSPVQVAEDVTFVEEYR RWLAYVLLLLLVLLVCLFTLLGLAKQSKWLVVV VMTAMSLLVLVLSWGSMGLEAATAV GLSDFC

SNPDTYVLNLTQEETGLSSD DILSYYFLCNQAVSNPFQQ RLTLSQRALASIHSQLQGLEREAIPQFSAAQ KPLLSLEETLNVTERSFHQLVALLHCR

SLHK DYGSALRGLCEDALEGLLFLMLFSLLSAGALATTLCSLPRAWALFPPS SDDYDDTDDDDPFNPQ ESKRFVQWQSSI 
Transcript ENSMUST00000119661
Sequence
CCCAATCTCCACCCCCGGCCCTCCGGGCTCCTGCTCCCGGGAGCCCCGCAAACCCCGCTCCGCCCGCGCCCCGCACAGCACCGAGGCTCCCGGCCCGGTC

CGCCCCGCTGCCCCTCCCCGGGGCCATGGGGGCACCCCCGGGCTACCGACCCTCTGCCTGGGTGCATCTCCTCCACCAGCTGCCCCGCGCCGACTTCCAG

CTCCGCCCGGTGCCCAGCGGCTTTGCTCCCCGCGACCAAGAGTACCAGCAG GCCCTGCTGCTGGTGGCAGCCTTGGCTGGGCTTGGTTTAGGCCTGAGC

CTCATCTTCATCGCTGTCTACCTCATCCGCTTCTGCTGCTGCAGGCCTCCAGAACCCCATGGGGCCAAGAGTCCCCCACCCGGAGGAGGTTGCGTCACCT

GGAGCTGCATTGCTGCCCTTCTCGTGGGCTG - UNI31852 - TGCCGGCATTGGCATTGGTTTCTATGGTAACAGCGAGACCAGCGATGGGGTGTCC

CAGCTCAGCTCAGCACTGCTGCACGCCAACCACACGCTCAGCACCATCGATGACGTG - UNI24162 - GTGCTGGAAACGGTGGAGAGGCTGGGTGA

GGCAGTGAAGACGGAGCTGACCACCCTGGAGGAAGTGCTGTCAGTCCGCATGGAGCTGGTGGCTGCCACCAGGGGAGCCCGAAGGCAGGCTGAAGCTGCT

GCTCAGTACCTGCAAGGACTGGCCTTCTGGCAAGGAGTGTCCCTGAGCCCCGTACAGGTGGCTGAAGATGTGACTTTCGTGGAGGAGTACAG GTGGCTG

GCCTATGTCCTCCTGCTGCTCTTGGTGCTTCTGGTTTGTCTCTTCACCCTCCTGGGCCTGGCAAAGCAGAGCAAATGGCTGGTGGTTGT GATGACTGCC

ATGAGTCTCCTGGTGCTTGTCCTGAGCTGGGGTTCTATGGGCCTAGAGGCTGCCACAGCTGTG GGCCTCAGTGACTTCTGCTCCAACCCAGACACCTAT

GTGCTGAACCTGACCCAGGAGGAGACAGGGCTCAGCTCAG ACATCCTCAGCTATTATTTCCTGTGCAACCAGGCGGTCTCCAACCCCTTCCAACAG AG

GCTGACGCTGTCCCAGCGTGCTCTAGCCAGCATCCACTCTCAGCTGCAGGGCCTGGAGCGGGAAGCTATCCCTCAATTTTCTGCTGCACAG AAGCCCTT

GTTATCCTTGGAGGAGACACTGAATGTGACAGAAAGAAGCTTCCACCAGTTGGTGGCGCTGCTGCACTGCCGCAGTCTGCACAAG GACTATGGCTCAGC

ACTCCGAGGCCTGTGTGAAGATGCCCTAGAGGGCCTACTGTTCCTGATGCTCTTTTCTCTCCTGTCTGCGGGGGCCCTAGCCACCACTCTGTGCAGCCTG

CCCCGCGCCTGGGCCCTCTTCCCACCCAG TGATGACTACGATGACACAGATGACGATGACCCTTTCAACCCTCAG GAATCCAAACGCTTTGTGCAGTG

GCAGTCTTCCATCTGAGCCTCCCCTCCAGTCTGGAGCCTGCCTCTCCTCTATG GCTCAGCACTGCATTGCTTCTATAAGTAACATGTGAATCCTGACAA

GGGGGAAGAAGCAGATACCGGAAGAGAATAAGCCTAGCACTAAATCTAAACAGGCGTGCAGCCACAGGAACAGTCAAGCTTCCAGTCCCGTGGAATGTAC

AAAGCCTGCTGGGTTTAGGAAAGGCGTGGAATCAACTTGCTTCCTAGCAGCTCACACCCAGCACAAGACTCCAGAAAACCAACGCTTGTATCAGAATAGG

GACAGAAGTCTTCGAAGAGAAAGTAGAATATTTGCTTGTAGTGCCACCAGGGTGATATGAAGGGGGAAGGTTTAAGGAAGATATTATAAATCCAGGCAGG

AAAAGATGAGGCACTCAATAAGTTATCAAGTAAAAACAAACATGGCAGAGTCAAAAGGGAAATTTATTGTCTGGGGAACAATATGTATGTAGTTCTCATT

TGTTTAAAAAACAAATAGCATACATGGCAAAGAAAAACGTGGTTAATACATAAACATAATTCAAAAAGCTTCTATTATCTAACAAAAAAGACCTCAATTT

AATAATAAGTAACTGAGAAAAACAAAAACCCCAAAACAAATGGATAAAATTGTCTTTTTTGTCTTTGTTGTTGTTGTTTTGGAGACAGGGTTTCTCTGTG

AAACAGCCCTGGGCTGTCCTGGAACTCTCTTTGTAGACCAGGCTGGCCTTGAACTCACAGAGAAGAGCCTGCCTCAGCCTCTGCCTCCCTAGTGAGGAGA

TTAACGGCGTGTGACGGCGTGTATCACCACACCCAACTAAAGTGTTCAAATTCTAATGATTAGCAAACACAATGTGCTACTTTCCCCTTTCGAGTACCTA

TTTGTTGTGGGATTTAGAGTGGAGTGTGGGCTGGTGCTGGTCTGGAGGCCCAGGGAACAGGTTCTCTAAATATGCTGCCCAGAGACTGTGAATCACCAGC

TATGTGAAAATAATAATAAACAAAACAAATAAAC
Translation
MGAPPGYRPSAWVHLLHQLPRADFQLRPVPSGFAPRDQEYQQ ALLLVAALAGLGLGLSLIFIAVYLIRFCCCRPPEPHGAKSPPPGGGCVTWSCIAALL

VGC - UNI31852 - CAGIGIGFYGNSETSDGVSQLSSALLHANHTLSTIDDV - UNI24162 - VLETVERLGEAVKTELTTLEEVLSVRMELVA

ATRGARRQAEAAAQYLQGLAFWQGVSLSPVQVAEDVTFVEEYR RWLAYVLLLLLVLLVCLFTLLGLAKQSKWLVVV VMTAMSLLVLVLSWGSMGLEAA

TAV GLSDFCSNPDTYVLNLTQEETGLSSD DILSYYFLCNQAVSNPFQQ RLTLSQRALASIHSQLQGLEREAIPQFSAAQ KPLLSLEETLNVTERSF

HQLVALLHCRSLHK DYGSALRGLCEDALEGLLFLMLFSLLSAGALATTLCSLPRAWALFPPS SDDYDDTDDDDPFNPQ ESKRFVQWQSSI 
Transcript ENSMUST00000079415
Sequence
GCTCCGCCCGCGCCCCGCACAGCACCGAGGCTCCCGGCCCGGTCCGCCCCGCTGCCCCTCCCCGGGGCCATGGGGGCACCCCCGGGCTACCGACCCTCTG

CCTGGGTGCATCTCCTCCACCAGCTGCCCCGCGCCGACTTCCAGCTCCGCCCGGTGCCCAGCGGCTTTGCTCCCCGCGACCAAGAGTACCAGCAG GCCC

TGCTGCTGGTGGCAGCCTTGGCTGGGCTTGGTTTAGGCCTGAGCCTCATCTTCATCGCTGTCTACCTCATCCGCTTCTGCTGCTGCAGGCCTCCAGAACC

CCATGGGGCCAAGAGTCCCCCACCCGGAGGAGGTTGCGTCACCTGGAGCTGCATTGCTGCCCTTCTCGTGGGCTG - UNI31852 - TGCCGGCATTG

GCATTGGTTTCTATGGTAACAGCGAGACCAGCGATGGGGTGTCCCAGCTCAGCTCAGCACTGCTGCACGCCAACCACACGCTCAGCACCATCGATGACGT

G - UNI24162 - GTGCTGGAAACGGTGGAGAGGCTGGGTGAGGCAGTGAAGACGGAGCTGACCACCCTGGAGGAAGTGCTGTCAGTCCGCATGGAGC

TGGTGGCTGCCACCAGGGGAGCCCGAAGGCAGGCTGAAGCTGCTGCTCAGTACCTGCAAGGACTGGCCTTCTGGCAAGGAGTGTCCCTGAGCCCCGTACA

GGTGGCTGAAGATGTGACTTTCGTGGAGGAGTACAG GTGGCTGGCCTATGTCCTCCTGCTGCTCTTGGTGCTTCTGGTTTGTCTCTTCACCCTCCTGGG

CCTGGCAAAGCAGAGCAAATGGCTGGTGGTTGT GATGACTGCCATGAGTCTCCTGGTGCTTGTCCTGAGCTGGGGTTCTATGGGCCTAGAGGCTGCCAC

AGCTGTG GGCCTCAGTGACTTCTGCTCCAACCCAGACACCTATGTGCTGAACCTGACCCAGGAGGAGACAGGGCTCAGCTCAG ACATCCTCAGCTATT

ATTTCCTGTGCAACCAGGCGGTCTCCAACCCCTTCCAACAG AGGCTGACGCTGTCCCAGCGTGCTCTAGCCAGCATCCACTCTCAGCTGCAGGGCCTGG

AGCGGGAAGCTATCCCTCAATTTTCTGCTGCACAG AAGCCCTTGTTATCCTTGGAGGAGACACTGAATGTGACAGAAAGAAGCTTCCACCAGTTGGTGG

CGCTGCTGCACTGCCGCAGTCTGCACAAG GACTATGGCTCAGCACTCCGAGGCCTGTGTGAAGATGCCCTAGAGGGCCTACTGTTCCTGATGCTCTTTT

CTCTCCTGTCTGCGGGGGCCCTAGCCACCACTCTGTGCAGCCTGCCCCGCGCCTGGGCCCTCTTCCCACCCAG TGATGACTACGATGACACAGATGACG

ATGACCCTTTCAACCCTCAG GAATCCAAACGCTTTGTGCAGTGGCAGTCTTCCATCTGAGCCTCCCCTCCAGTCTGGAGCCTGCCTCTCCTCTATG CT

CCTTTCCTGGCTGCTGGAGAAGGCCCCACTAACCTGACCTTGACTGGGCTCTGACCACTAACACTGCTGGCTATGGACATCTCACTTAGGATGGCAACCT

GCTCTGGCCCTAACACCCACCCCCCCATCCCCATTTCTCCTTAGCACAGGGGATTGCTGAGGTGGCACAACAGGGACCAGGGGTGGCTGGGAAGGGGGCT

GACCTATACAGCCTGGTGTTCCTCACCTCTGGCTGCCAGTCCTGTCCTTGGAGGGATGAAGCTGGAGGCAGGTACAGGCACGTCCCTGTTTCCTGCCATA

CCCCAGCGATCTCAACCTATGGCACTAACTTGGAAGAGGGCTGATTTGAAATAAAAGGGAAGGCTTTATTTTACAAGCAGCTAGGTCCTTCTTATCCACC

CCAACTACTGAGAGAAGGAAGTCCTGACTGGGCTAGGGACACTCCTCCTCTGGTGGTTGAAAGGCAACTCTCCTCTTGTCCAGGCTCAGCACTGCATTGC

TTCTATAAGTAACATGTGAATCCTGACAAGGGGGAAGAAGCAGATACCGGAAGAGAATAAGCCTAGCACTAAATCTAAACAGGCGTGCAGCCACAGGAAC

AGTCAAGCTTCCAGTCCCGTGGAATGTACAAAGCCTGCTGGGTTTAGGAAAGGCGTGGAATCAACTTGCTTCCTAGCAGCTCACACCCAGCACAAGACTC

CAGAAAACCAACGCTTGTATCAGAATAGGGACAGAAGTCTTCGAAGAGAAAGTAGAATATTTGCTTGTAGTGCCACCAGGGTGATATGAAGGGGGAAGGT

TTAAGGAAGATATTATAAATCCAGGCAGGAAAAGATGAGGCACTCAATAAGTTATCAAGTAAAAACAAACATGGCAGAGTCAAAAGGGAAATTTATTGTC

TGGGGAACAATATGTATGTAGTTCTCATTTGTTTAAAAAACAAATAGCATACATGGCAAAGAAAAACGTGGTTAATACATAAACATAATTCAAAAAGCTT

CTATTATCTAACAAAAAAGACCTCAATTTAATAATAAGTAACTGAGAAAAACAAAAACCCCAAAACAAATGGATAAAATTGTCTTTTTTGTCTTTGTTGT

TGTTGTTTTGGAGACAGGGTTTCTCTGTGAAACAGCCCTGGGCTGTCCTGGAACTCTCTTTGTAGACCAGGCTGGCCTTGAACTCACAGAGAAGAGCCTG

CCTCAGCCTCTGCCTCCCTAGTGAGGAGATTAACGGCGTGTGACGGCGTGTATCACCACACCCAACTAAAGTGTTCAAATTCTAATGATTAGCAAACACA

ATGTGCTACTTTCCCCTTTCGAGTACCTATTTGTTGTGGGATTTAGAGTGGAGTGTGGGCTGGTGCTGGTCTGGAGGCCCAGGGAACAGGTTCTCTAAAT

ATGCTGCCCAGAGACTGTGAATCACCAGCTATGTGAAAATAATAATAAACAAAACAAATAAACAAACATAAATATGCT
Translation
MGAPPGYRPSAWVHLLHQLPRADFQLRPVPSGFAPRDQEYQQ ALLLVAALAGLGLGLSLIFIAVYLIRFCCCRPPEPHGAKSPPPGGGCVTWSCIAALL

VGC - UNI31852 - CAGIGIGFYGNSETSDGVSQLSSALLHANHTLSTIDDV - UNI24162 - VLETVERLGEAVKTELTTLEEVLSVRMELVA

ATRGARRQAEAAAQYLQGLAFWQGVSLSPVQVAEDVTFVEEYR RWLAYVLLLLLVLLVCLFTLLGLAKQSKWLVVV VMTAMSLLVLVLSWGSMGLEAA

TAV GLSDFCSNPDTYVLNLTQEETGLSSD DILSYYFLCNQAVSNPFQQ RLTLSQRALASIHSQLQGLEREAIPQFSAAQ KPLLSLEETLNVTERSF

HQLVALLHCRSLHK DYGSALRGLCEDALEGLLFLMLFSLLSAGALATTLCSLPRAWALFPPS SDDYDDTDDDDPFNPQ ESKRFVQWQSSI 
Transcript ENSMUST00000086397
Sequence
GGGGCCATGGGGGCACCCCCGGGCTACCGACCCTCTGCCTGGGTGCATCTCCTCCACCAGCTGCCCCGCGCCGACTTCCAGCTCCGCCCGGTGCCCAGCG

GCTTTGCTCCCCGCGACCAAGAGTACCAGCAG GCCCTGCTGCTGGTGGCAGCCTTGGCTGGGCTTGGTTTAGGCCTGAGCCTCATCTTCATCGCTGTCT

ACCTCATCCGCTTCTGCTGCTGCAGGCCTCCAGAACCCCATGGGGCCAAGAGTCCCCCACCCGGAGGAGGTTGCGTCACCTGGAGCTGCATTGCTGCCCT

TCTCGTGGGCTG - UNI31852 - TGCCGGCATTGGCATTGGTTTCTATGGTAACAGCGAGACCAGCGATGGGGTGTCCCAGCTCAGCTCAGCACTGC

TGCACGCCAACCACACGCTCAGCACCATCGATGACGTG - UNI24162 - GTGCTGGAAACGGTGGAGAGGCTGGGTGAGGCAGTGAAGACGGAGCTG

ACCACCCTGGAGGAAGTGCTGTCAGTCCGCATGGAGCTGGTGGCTGCCACCAGGGGAGCCCGAAGGCAGGCTGAAGCTGCTGCTCAGTACCTGCAAGGAC

TGGCCTTCTGGCAAGGAGTGTCCCTGAGCCCCGTACAGGTGGCTGAAGATGTGACTTTCGTGGAGGAGTACAG GTGGCTGGCCTATGTCCTCCTGCTGC

TCTTGGTGCTTCTGGTTTGTCTCTTCACCCTCCTGGGCCTGGCAAAGCAGAGCAAATGGCTGGTGGTTGT GATGACTGCCATGAGTCTCCTGGTGCTTG

TCCTGAGCTGGGGTTCTATGGGCCTAGAGGCTGCCACAGCTGTG GGCCTCAGTGACTTCTGCTCCAACCCAGACACCTATGTGCTGAACCTGACCCAGG

AGGAGACAGGGCTCAGCTCAG ACATCCTCAGCTATTATTTCCTGTGCAACCAGGCGGTCTCCAACCCCTTCCAACAG AGGCTGACGCTGTCCCAGCGT

GCTCTAGCCAGCATCCACTCTCAGCTGCAGGGCCTGGAGCGGGAAGCTATCCCTCAATTTTCTGCTGCACAG AAGCCCTTGTTATCCTTGGAGGAGACA

CTGAATGTGACAGAAAGAAGCTTCCACCAGTTGGTGGCGCTGCTGCACTGCCGCAGTCTGCACAAG GACTATGGCTCAGCACTCCGAGGCCTGTGTGAA

GATGCCCTAGAGGGCCTACTGTTCCTGATGCTCTTTTCTCTCCTGTCTGCGGGGGCCCTAGCCACCACTCTGTGCAGCCTGCCCCGCGCCTGGGCCCTCT

TCCCACCCAG GAATCCAAACGCTTTGTGCAGTGGCAGTCTTCCATCTGAGCCTCCCCTCCAGTCTGGAGCCTGC TCTCCTCTATG CTCCTTTCCTGG

CTGCTGGAGAAGGCCCCACTAA
Translation
MGAPPGYRPSAWVHLLHQLPRADFQLRPVPSGFAPRDQEYQQ ALLLVAALAGLGLGLSLIFIAVYLIRFCCCRPPEPHGAKSPPPGGGCVTWSCIAALL

VGC - UNI31852 - CAGIGIGFYGNSETSDGVSQLSSALLHANHTLSTIDDV - UNI24162 - VLETVERLGEAVKTELTTLEEVLSVRMELVA

ATRGARRQAEAAAQYLQGLAFWQGVSLSPVQVAEDVTFVEEYR RWLAYVLLLLLVLLVCLFTLLGLAKQSKWLVVV VMTAMSLLVLVLSWGSMGLEAA

TAV GLSDFCSNPDTYVLNLTQEETGLSSD DILSYYFLCNQAVSNPFQQ RLTLSQRALASIHSQLQGLEREAIPQFSAAQ KPLLSLEETLNVTERSF

HQLVALLHCRSLHK DYGSALRGLCEDALEGLLFLMLFSLLSAGALATTLCSLPRAWALFPPR RNPNALCSGSLPSEPPLQSGAC SPLC CSFPGCWR

RPH
Transcript ENSMUST00000032594
Sequence
CCCAATCTCCACCCCCGGCCCTCCGGGCTCCTGCTCCCGGGAGCCCCGCAAACCCCGCTCCGCCCGCGCCCCGCACAGCACCGAGGCTCCCGGCCCGGTC

CGCCCCGCTGCCCCTCCCCGGGGCCATGGGGGCACCCCCGGGCTACCGACCCTCTGCCTGGGTGCATCTCCTCCACCAGCTGCCCCGCGCCGACTTCCAG

CTCCGCCCGGTGCCCAGCGGCTTTGCTCCCCGCGACCAAGAGTACCAGCAG GCCCTGCTGCTGGTGGCAGCCTTGGCTGGGCTTGGTTTAGGCCTGAGC

CTCATCTTCATCGCTGTCTACCTCATCCGCTTCTGCTGCTGCAGGCCTCCAGAACCCCATGGGGCCAAGAGTCCCCCACCCGGAGGAGGTTGCGTCACCT

GGAGCTGCATTGCTGCCCTTCTCGTGGGCTG - UNI31852 - TGCCGGCATTGGCATTGGTTTCTATGGTAACAGCGAGACCAGCGATGGGGTGTCC

CAGCTCAGCTCAGCACTGCTGCACGCCAACCACACGCTCAGCACCATCGATGACGTG - UNI24162 - GTGCTGGAAACGGTGGAGAGGCTGGGTGA

GGCAGTGAAGACGGAGCTGACCACCCTGGAGGAAGTGCTGTCAGTCCGCATGGAGCTGGTGGCTGCCACCAGGGGAGCCCGAAGGCAGGCTGAAGCTGCT

GCTCAGTACCTGCAAGGACTGGCCTTCTGGCAAGGAGTGTCCCTGAGCCCCGTACAGGTGGCTGAAGATGTGACTTTCGTGGAGGAGTACAG GTGGCTG

GCCTATGTCCTCCTGCTGCTCTTGGTGCTTCTGGTTTGTCTCTTCACCCTCCTGGGCCTGGCAAAGCAGAGCAAATGGCTGGTGGTTGT GATGACTGCC

ATGAGTCTCCTGGTGCTTGTCCTGAGCTGGGGTTCTATGGGCCTAGAGGCTGCCACAGCTGTG GGCCTCAGTGACTTCTGCTCCAACCCAGACACCTAT

GTGCTGAACCTGACCCAGGAGGAGACAGGGCTCAGCTCAG ACATCCTCAGCTATTATTTCCTGTGCAACCAGGCGGTCTCCAACCCCTTCCAACAG AG

GCTGACGCTGTCCCAGCGTGCTCTAGCCAGCATCCACTCTCAGCTGCAGGGCCTGGAGCGGGAAGCTATCCCTCAATTTTCTGCTGCACAG AAGCCCTT

GTTATCCTTGGAGGAGACACTGAATGTGACAGAAAGAAGCTTCCACCAGTTGGTGGCGCTGCTGCACTGCCGCAGTCTGCACAAG GACTATGGCTCAGC

ACTCCGAGGCCTGTGTGAAGATGCCCTAGAGGGCCTACTGTTCCTGATGCTCTTTTCTCTCCTGTCTGCGGGGGCCCTAGCCACCACTCTGTGCAGCCTG

CCCCGCGCCTGGGCCCTCTTCCCACCCAG GAATCCAAACGCTTTGTGCAGTGGCAGTCTTCCATCTGAGCCTCCCCTCCAGTCTGGAGCCTGCCTCTCC

TCTATG CTCCTTTCCTGGCTGCTGGAGAAGGCCCCACTAACCTGACCTTGACTGGGCTCTGACCACTAACACTGCTGGCTATGGACATCTCACTTAGGA

TGGCAACCTGCTCTGGCCCTAACACCCACCCCCCCATCCCCATTTCTCCTTAGCACAGGGGATTGCTGAGGTGGCACAACAGGGACCAGGGGTGGCTGGG

AAGGGGGCTGACCTATACAGCCTGGTGTTCCTCACCTCTGGCTGCCAGTCCTGTCCTTGGAGGGATGAAGCTGGAGGCAGGTACAGGCACGTCCCTGTTT

CCTGCCATACCCCAGCGATCTCAACCTATGGCACTAACTTGGAAGAGGGCTGATTTGAAATAAAAGGGAAGGCTTTATTTTACAAGCAGCTAGGTCCTTC

TTATCCACCCCAACTACTGAGAGAAGGAAGTCCTGACTGGGCTAGGGACACTCCTCCTCTGGTGGTTGAAAGGCAACTCTCCTCTTGTCCAGGCTCAGCA

CTGCATTGCTTCTATAAGTAACATGTGAATCCTGACAAGGGGGAAGAAGCAGATACCGGAAGAGAATAAGCCTAGCACTAAATCTAAACAGGCGTGCAGC

CACAGGAACAGTCAAGCTTCCAGTCCCGTGGAATGTACAAAGCCTGCTGGGTTTAGGAAAGGCGTGGAATCAACTTGCTTCCTAGCAGCTCACACCCAGC

ACAAGACTCCAGAAAACCAACGCTTGTATCAGAATAGGGACAGAAGTCTTCGAAGAGAAAGTAGAATATTTGCTTGTAGTGCCACCAGGGTGATATGAAG

GGGGAAGGTTTAAGGAAGATATTATAAATCCAGGCAGGAAAAGATGAGGCACTCAATAAGTTATCAAGTAAAAACAAACATGGCAGAGTCAAAAGGGAAA

TTTATTGTCTGGGGAACAATATGTATGTAGTTCTCATTTGTTTAAAAAACAAATAGCATACATGGCAAAGAAAAACGTGGTTAATACATAAACATAATTC

Translation
MGAPPGYRPSAWVHLLHQLPRADFQLRPVPSGFAPRDQEYQQ ALLLVAALAGLGLGLSLIFIAVYLIRFCCCRPPEPHGAKSPPPGGGCVTWSCIAALL

VGC - UNI31852 - CAGIGIGFYGNSETSDGVSQLSSALLHANHTLSTIDDV - UNI24162 - VLETVERLGEAVKTELTTLEEVLSVRMELVA

ATRGARRQAEAAAQYLQGLAFWQGVSLSPVQVAEDVTFVEEYR RWLAYVLLLLLVLLVCLFTLLGLAKQSKWLVVV VMTAMSLLVLVLSWGSMGLEAA

TAV GLSDFCSNPDTYVLNLTQEETGLSSD DILSYYFLCNQAVSNPFQQ RLTLSQRALASIHSQLQGLEREAIPQFSAAQ KPLLSLEETLNVTERSF

HQLVALLHCRSLHK DYGSALRGLCEDALEGLLFLMLFSLLSAGALATTLCSLPRAWALFPPR RNPNALCSGSLPSEPPLQSGACLSSM LLSWLLEKA

PLT
Transcript ENSMUST00000086398
Sequence
CCCAATCTCCACCCCCGGCCCTCCGGGCTCCTGCTCCCGGGAGCCCCGCAAACCCCGCTCCGCCCGCGCCCCGCACAGCACCGAGGCTCCCGGCCCGGTC

CGCCCCGCTGCCCCTCCCCGGGGCCATGGGGGCACCCCCGGGCTACCGACCCTCTGCCTGGGTGCATCTCCTCCACCAGCTGCCCCGCGCCGACTTCCAG

CTCCGCCCGGTGCCCAGCGGCTTTGCTCCCCGCGACCAAGAGTACCAGCAG GCCCTGCTGCTGGTGGCAGCCTTGGCTGGGCTTGGTTTAGGCCTGAGC

CTCATCTTCATCGCTGTCTACCTCATCCGCTTCTGCTGCTGCAGGCCTCCAGAACCCCATGGGGCCAAGAGTCCCCCACCCGGAGGAGGTTGCGTCACCT

GGAGCTGCATTGCTGCCCTTCTCGTGGGCTG - UNI31852 - TGCCGGCATTGGCATTGGTTTCTATGGTAACAGCGAGACCAGCGATGGGGTGTCC

CAGCTCAGCTCAGCACTGCTGCACGCCAACCACACGCTCAGCACCATCGATGACGTG - UNI24162 - GTGCTGGAAACGGTGGAGAGGCTGGGTGA

GGCAGTGAAGACGGAGCTGACCACCCTGGAGGAAGTGCTGTCAGTCCGCATGGAGCTGGTGGCTGCCACCAGGGGAGCCCGAAGGCAGGCTGAAGCTGCT

GCTCAGTACCTGCAAGGACTGGCCTTCTGGCAAGGAGTGTCCCTGAGCCCCGTACAGGTGGCTGAAGATGTGACTTTCGTGGAGGAGTACAG GTGGCTG

GCCTATGTCCTCCTGCTGCTCTTGGTGCTTCTGGTTTGTCTCTTCACCCTCCTGGGCCTGGCAAAGCAGAGCAAATGGCTGGTGGTTGT GATGACTGCC

ATGAGTCTCCTGGTGCTTGTCCTGAGCTGGGGTTCTATGGGCCTAGAGGCTGCCACAGCTGTG GGCCTCAGTGACTTCTGCTCCAACCCAGACACCTAT

GTGCTGAACCTGACCCAGGAGGAGACAGGGCTCAGCTCAG ACATCCTCAGCTATTATTTCCTGTGCAACCAGGCGGTCTCCAACCCCTTCCAACAG AG

GCTGACGCTGTCCCAGCGTGCTCTAGCCAGCATCCACTCTCAGCTGCAGGGCCTGGAGCGGGAAGCTATCCCTCAATTTTCTGCTGCACAG AAGCCCTT

GTTATCCTTGGAGGAGACACTGAATGTGACAGAAAGAAGCTTCCACCAGTTGGTGGCGCTGCTGCACTGCCGCAGTCTGCACAAG GACTATGGCTCAGC

ACTCCGAGGCCTGTGTGAAGATGCCCTAGAGGGCCTACTGTTCCTGATGCTCTTTTCTCTCCTGTCTGCGGGGGCCCTAGCCACCACTCTGTGCAGCCTG

CCCCGCGCCTGGGCCCTCTTCCCACCCAG TGATGACTACGATGACACAGATGACGATGACCCTTTCAACCCTCAG GAAAACCAACGCTTGTATCAGAA

TAGGGACAGAAGTCTTCGAAGAGAAAGTAGAATATTTGCTTGTAGTGCCACCAGGGTGATATGA
Translation
MGAPPGYRPSAWVHLLHQLPRADFQLRPVPSGFAPRDQEYQQ ALLLVAALAGLGLGLSLIFIAVYLIRFCCCRPPEPHGAKSPPPGGGCVTWSCIAALL

VGC - UNI31852 - CAGIGIGFYGNSETSDGVSQLSSALLHANHTLSTIDDV - UNI24162 - VLETVERLGEAVKTELTTLEEVLSVRMELVA

ATRGARRQAEAAAQYLQGLAFWQGVSLSPVQVAEDVTFVEEYR RWLAYVLLLLLVLLVCLFTLLGLAKQSKWLVVV VMTAMSLLVLVLSWGSMGLEAA

TAV GLSDFCSNPDTYVLNLTQEETGLSSD DILSYYFLCNQAVSNPFQQ RLTLSQRALASIHSQLQGLEREAIPQFSAAQ KPLLSLEETLNVTERSF

HQLVALLHCRSLHK DYGSALRGLCEDALEGLLFLMLFSLLSAGALATTLCSLPRAWALFPPS SDDYDDTDDDDPFNPQ ENQRLYQNRDRSLRRESRI

FACSATRVI

For any suggestions or comments, please send an email to unitrap@crg.es