Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030493 (C230052I12Rik)
Chromosomal location
Chr 7: 36177324 - 36181827 (-)
Description
RIKEN cDNA C230052I12 gene Gene [Source:MGI Symbol;Acc:MGI:2142208]
RefSeq_peptide
NP_848758.1 
UniGene
Mm.389855 
MGI
MGI:2142208 
Uniprot/SWISSPROT
Q8BHL6 
Human Ortholog
not available
Omim not available
UniTrap UNI34618
Vector Insertion
Chr 7: 36180255 - 36181828
Public Clones IST14894B3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37030
Vector Insertion
Chr 7: 36178111 - 36179993
Public Clones CMHD-GT_241C8-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000032704
Sequence
GAAGTGGCAGGGCCTCAGGTGAGGTCCACGGAGATTCTAGACCCCGGCGCAGTGAGCTTCCCTGCCTTTGTAGCCCTGGACAGGAACCGAATAGAAGGAC

AGGGACCGAATGGAAGAGCCACCGTAAGCGTCCTGTTAGGACACCAGAGCTAAGGGAGGTGCTTACAAAGAGGGACGGAGTCACTCAAACAGAAATCTCC

CGGGTTTAGCTCGGGGTAGTGGCGCCCGGCTGTCATTTTAGCACTTGGGCTGCTGAGTTCAAGTCCAGCTGGAGTCAACTATCAGTACAGAGCCAAGCGT

GATAAGAAGACCCAGTCTTATTTTGAAAATAAATAATCTCTTGAATTCAGACTTCGGTTGAAGTAGCTCAGTGCCTGAAAATCCACTCTACAGATCCTGT

CAAAGAGGTCCCGACTTCGTGTAGAACTGTGTGCAACAGCGCCTGCTCTAGTGAGACCTTGCATTTTCCTCATTTAGACCAAAACCACGGATGGAAAGGA

ACCCGCCTGATGGGACCGGTCCGGTCCACGTGCCACTAGGACATATTGTGGCTAGTGAAAAATGGCGCGGGTCCCAACTGGCTCAGGAGATGCAAG - U

NI34618 - GAAAAGTTAGACTCATTTTTGAGGAGGGCCTGGCATCAGCAGATTTTTACCTGTCTAGCAAATCTTGCATTCTCTATGTCACTGAAGCAG

ATTTGGTGGCCGGACATGGCTACAGAAAAAGACTCGCTCGCTTTAGAAAT - UNI34618 - TCCTCACATCTTCAAGGGATCATAATAGTTGAGAAG

ACCCAGATGAGTGAACAGTATTTCCCAGCAGTCCAGAAGTTTACTGTGCTAGACCTTGGGATGGTGCTGCTTCCAGTGGCCAGCCAGTCGGAAGCATCCT

GCCTCATTATCCACTTG GTTCAAGAGCAAACCAGAGAGCCCAGCAAGAACCCTTTCCTCAGGAAAAAGCGCTCCATGCTCTCCGAGCTCTCCCTTGTTC

AAACAGTGCAGCAGATCCCAGGGGTTGGGAAAGTTAAGGCCCCCCTTCTGCTCCAGAAGTTTCCGAGCATCCAGCAACTGAGCAACGCTTCCGTCCAAGA

ACTGGAGGAGGTCGTGGGGCCCGCGGCAGCACAGCAAATCCACACCTTCTTCACCCAGCCTAAGCGACAGCAGCCCCGCAGCTGACTCTGCCTTCAGACT

TCAAACTGCAGCGTCTGGTTTCCATATTTAAAAAGAAGGAAAAGTTCCCCTGTCAATGGCAATGGGCTAAAGACAAGGAGAGGACCGATGAGGCTCGCAG

TCACCCTGCCTCGGTGTCTGTCTGGGCAGCCACCTGGTGGGGCTTGGGGGTCGCGGGCGGCACTGGCCACTTTCTGCTAAGATGAAGAGGGTCCCCACGG

GGATCATCCAGAGACTCATTCCCAGCCGCAGCCAGCTGGAGCAGATTTGTACAAGACTCTCTGCCCTGCCTCTGTCACTGAGAGGCCCTGTGAGGGTCCA

GCGCTGAGTAGGGAGTGTCCCCGTTAACCAGTGTCAGGGCCACAGCTCAGGTCTTCTCCACACTCGTCAGGTACCTGTGCTATGGAGTTTCTGCCCGAGT

CAACAAACGCCTTTCCTCCCGCATCACCCCTCCCCCCAATCAACACAAGAAAACTATGCTGTGCTTTGGATGACGTGGAAGAAATAATTAGGATGAAATA

AAAGC
Translation
MERNPPDGTGPVHVPLGHIVASEKWRGSQLAQEMQG - UNI34618 - GKVRLIFEEGLASADFYLSSKSCILYVTEADLVAGHGYRKRLARFRN - 

UNI34618 - SSHLQGIIIVEKTQMSEQYFPAVQKFTVLDLGMVLLPVASQSEASCLIIHL VQEQTREPSKNPFLRKKRSMLSELSLVQTVQQIPGVG

KVKAPLLLQKFPSIQQLSNASVQELEEVVGPAAAQQIHTFFTQPKRQQPRS

For any suggestions or comments, please send an email to unitrap@crg.es