Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030494 (Rhpn2)
Chromosomal location
Chr 7: 36119333 - 36177304 (+)
Description
rhophilin, Rho GTPase binding protein 2 Gene [Source:MGI (curated);Acc:Rhpn2-001]
RefSeq_dna
NM_027897 
RefSeq_peptide
NP_082173.2 
UniGene
Mm.286600 
MGI
MGI:1289234 
Uniprot/SWISSPROT
Q8BWR8 
Uniprot/SPTREMBL
Q497Z4 
Human Ortholog
ENSG00000131941 (RHPN2)
Omim not available
UniTrap UNI31609
Vector Insertion
Chr 7: 36119431 - 36138750
Public Clones IST13075D7 (tigm) IST14165G4 (tigm) IST14549A7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20200
Vector Insertion
Chr 7: 36138867 - 36145998
Public Clones not available
Private Clones OST369729 (lexicon) OST369217 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9940
Vector Insertion
Chr 7: 36166551 - 36168987
Public Clones XD013 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000032705
Sequence
GGACTCCCGCGCTGCCAGCATGACCGATACGCTGCTACCCGCGGCTCCCCAGCCGCTGGAGAAAGAGGGTGACGACTACTTTCGAAAG - UNI31609 

- GGTTGTAATCCCCTTGCACAAACTGGCCGGAGCAAGCTGCAGAATCAAAGGGCTGCCTTGAACCAGCAGATCCTGAAGGCTGTGCGGATGCGGACAGG

AGCCGAGAACCTTCTGAA - UNI20200 - GGTCGCCACAAACCAGAAGGTGCGGGAACAGGTTCGCCTGGAGCTGAGCTTTGTCAACTCAGACCTGC

AGATGCTGAAGGAGGAGCTGGAGGGGCTCAACATCTCCGTGGGAGTGTACCAGGGCACCGA GGAAGCGTTCACCATTCCTCTGATTCCTCTCGGCCTGA

AGGAGACCAAAGAAGTTGACTTTTCCATCGTCTTCAAG GATTTTATTTTGGAACACTACAGTGAAGATAGCTATTTGTATGAGGATGACATTGCAGACC

TTATGGACCTGCGACAG GCCTGTCGAACACCCAGCAGGGATGAGGCGGGGGTCGAACTGCTCATGTCGTACTTCATTCAGCTGGGCTTTGTGGAGAGCA

GGTTCTTCCCACCCACGCGTCACATGGGGCTCCTGTTTACCTG GTATGACTCCTTCACTGGGGTTCCGGTCAGCCAGCAGACTTTGCTGTTGGAGAAGG

CCAGCGTTCTCTTCAACATTGGGGCGCTCTACACCCAGATCGGGACCCGCTGTAACCGGCAGACGCAGGCTGGCTTAGAGAGCGCTGTGGATGCCTTTCA

AAGAGCTGCAG GGGTTTTAAACTACCTGAAAGAGACCTTCACTCACACTCCAAGTTACGACATGAGCCCTGCCATGCTCAGTGTGCTGGTCAAAATGAT

GCTCGCCCAAGCCCAAGAAAGTGTGTTTGAGAAAGTCTGCCTCCCGGGGATCCAGAACGAGTTCTTCGTGCTGGTAAAGGTGGCTCAGGAGGCTGCCAAG

 GTGGCAGAGGCCTACCGGCAGCTGCATGCGGCCATGAGCCAGGAACCAGTGAAAGAGAACATCCCGTATTCGTGGGCCAGTGTGGCCTATGTGAAGGCC

TACCACTATGGGGCCCTGGCTCACTACTTTGCGGCCACCCTCCTCATCGACCACCAGC TAAAGCCAGGCGCAGACGAGGACCACCAAGAGAAGTGTCTG

TCCCAGCTCTATGACCGCATGCCAGAAGGGATGACGCCGCTGGCCACGCTGAAGAATGCTGGGCAGCGTGTGCTGCTGG GTAAAGGACATCTGCACCGG

GCCATTGGTTTTCACGAGGAGTCACTGAGGGAGGCCAACCTGTGCAAGAAGCTGCGTGACATTCAGGTGCTCCGGGATGTGCTGTCTGCTGCCCATCAGC

GCACTCAGCTCAAGCACACCCAGCACCGAGAGGATGACGACCTTCTGAACCTGATTGACGCTCCAGATGTCCTTC - UNI9940 - CAAAAACTGAGC

GAGAGGTCAAAATAACCTTCCCCGACTTTTCCAAAGTGACAGTGACAGACTTCTTCCAGAAGCTG GGTCCCCTGTCTGTGTTTTCGGCCAGCAAGAGAT

GGTCACCTCCTCGGGGCATTCACTTCACAGTGGAGGAAGGGGACTTGGGGTTCACCTTACGAGGGAACACCCCAGTCCAGGTACACTTCCTGGATCCTCA

CTGCTCTGCTTCG CTTGCAGGGGCCAAGGAAGGAGATTACATTGTTTCCATTCAAGGCGTGGATTGCAAGTGGCTGACAGTGAGTGAGGTTATGAAGTT

GCTGAAGAGCTTTGGGGGAGAAGAGGTTGAGATGAAGGTCGTGAGCCTCCTGGACTCCACATCGTCCATG CATAATAAGTGTGCCACTTACTCTGTGGG

GATGCAGAAAACTTACTCCATGATATGCCTGTCCATGGACGATGATGACAAAGCTGACAAAACCAAGAAGATCTCAAAAAAGCTCTCCTTCTTGAGTTGG

GGCACTAGTAAAAACAGACAGAAGTCGGCCAGCACGCTGTGCCTCCCCGAGGTTGGCCTGGCGAGGTCGCAAAACAAGAAGAAACTCCCGACTCCCTTCA

GCCTGCTCAACTCTGACAGCTCTCTGTACTGAAGGGAGGAGCCAGAACAGGCCACACCGAGGTCGCCACAGCTGCCTAACCGCCCATGCCGCGATGGGAC

TGTTCTCCAACCCCATCTTCTCAGACTGTAAACTTTGATGTGCTTGTGAACATGAAAAAGAGACCTCTAGAAATTGGTGAGAAACCCAGCCGCATGGGGA

TTTTCACATTGCTGCAGTTATTTATTCTATAATGTAGGGCATAGAAGAGCCTGAATATTTTAGCTGTTTTTTTTGGTTTTCCAAGACAATTTTCTGTGTA

GCCCTGCCTGCCTTAGAAGTTGCCCTGGTGACCAGGCTGGCCTCGAACTTTGAGATCCACCTGCCTCTGCCTCCCAAGTGCTGGGATTAAGGTGTGTGCC

ACCACCACCCAGCAGCTGCTATTACTGTTTTTCTTGGCTGTGATTATGATATTCAGGCACCGTGAGAGATGAATTGGGACCACCTACTTTGGTACTATAT

CCGAGTGTTTAGATTTGTATAGTAGTGATTTCTTAAGTTCAAGTGACTCTTGAGTGGAGGCAGGTTAGAGGTGTTAACTAAAACCAGGCTGCTTGGAAGA

TTTCTGTGAGTTTGAGGCCAGCCTGGTCGACATAGTGAGTTCCAGGACAGCTGGGGCTACACAGAGAAACCCTCTCTCAAACAAACAAAACCGAAACAGG

CTGCTTTAAGTACTTGGGAATTCATGAGATGAAATGACACATCTTCTGTCATCCCTGCATAATTTGACTGTTCTTTCCCAGATGAAGTCTAGTGCCAATT

TTGTCTTTCCTTCCTCCAGAATCAGCCCCCCTCAGCTATATCATACTGACCAGTAGCTAACACAGTGGCAGTGTTAGGAGATACCGTCTACAGGGTAGAT

AATATGCTGTTTGATACTCAAAACGTTGCTCTTTTTGTTTAAAGTAGGAGGTATGTAACTGTGTATTTTAAGAGTCTTGGTTTAAGTAGTAGTTTCGCAG

TTTACAAGGTAAAGACGTAAACTTACTCAAGTTGAAACCTCTACTCGACTTTGTAAGATGTATCTACCAACTTGACTTTGGGGCTATAGGTTGGATGACA

CTGTGACAGAGTCACGGTTGACACAGTTCAAGTGATAAGTTTAAGGATATATAGCCTGTGGATCTTAAAGTAACAAGGATTTAAATATTTTTCTATTGTG

CAATATCTGGAGAACACAAATGCCTTAAGGAAAGTGTGCCCGCTATCCCTGGGGCTCTGTTTGTATAAATATTTAAATAAAGTCATGTTCATTGTTTGAG

TT
Translation
MTDTLLPAAPQPLEKEGDDYFRK - UNI31609 - GCNPLAQTGRSKLQNQRAALNQQILKAVRMRTGAENLLK - UNI20200 - KVATNQKVRE

QVRLELSFVNSDLQMLKEELEGLNISVGVYQGTE EEAFTIPLIPLGLKETKEVDFSIVFK DFILEHYSEDSYLYEDDIADLMDLRQ ACRTPSRDEAG

VELLMSYFIQLGFVESRFFPPTRHMGLLFTW WYDSFTGVPVSQQTLLLEKASVLFNIGALYTQIGTRCNRQTQAGLESAVDAFQRAAG GVLNYLKETF

THTPSYDMSPAMLSVLVKMMLAQAQESVFEKVCLPGIQNEFFVLVKVAQEAAK VAEAYRQLHAAMSQEPVKENIPYSWASVAYVKAYHYGALAHYFAAT

LLIDHQL LKPGADEDHQEKCLSQLYDRMPEGMTPLATLKNAGQRVLLG GKGHLHRAIGFHEESLREANLCKKLRDIQVLRDVLSAAHQRTQLKHTQHR

EDDDLLNLIDAPDVLP - UNI9940 - PKTEREVKITFPDFSKVTVTDFFQKL GPLSVFSASKRWSPPRGIHFTVEEGDLGFTLRGNTPVQVHFLDP

HCSAS LAGAKEGDYIVSIQGVDCKWLTVSEVMKLLKSFGGEEVEMKVVSLLDSTSSM HNKCATYSVGMQKTYSMICLSMDDDDKADKTKKISKKLSFL

SWGTSKNRQKSASTLCLPEVGLARSQNKKKLPTPFSLLNSDSSLY
Transcript ENSMUST00000085556
Sequence
AGTTCACCCTGGACTCCCGCGCTGCCAGCATGACCGATACGCTGCTACCCGCGGCTCCCCAGCCGCTGGAGAAAGAGGGTGACGACTACTTTCGAAAG -

 UNI31609 - GGTTGTAATCCCCTTGCACAAACTGGCCGGAGCAAGCTGCAGAATCAAAGGGCTGCCTTGAACCAGCAGATCCTGAAGGCTGTGCGGA

TGCGGACAGGAGCCGAGAACCTTCTGAA - UNI20200 - GGTCGCCACAAACCAGAAGGTGCGGGAACAGGTTCGCCTGGAGCTGAGCTTTGTCAAC

TCAGACCTGCAGATGCTGAAGGAGGAGCTGGAGGGGCTCAACATCTCCGTGGGAGTGTACCAGGGCACCGA GGAAGCGTTCACCATTCCTCTGATTCCT

CTCGGCCTGAAGGAGACCAAAGAAGTTGACTTTTCCATCGTCTTCAAG GATTTTATTTTGGAACACTACAGTGAAGATAGCTATTTGTATGAGGATGAC

ATTGCAGACCTTATGGACCTGCGACAG GCCTGTCGAACACCCAGCAGGGATGAGGCGGGGGTCGAACTGCTCATGTCGTACTTCATTCAGCTGGGCTTT

GTGGAGAGCAGGTTCTTCCCACCCACGCGTCACATGGGGCTCCTGTTTACCTG GTATGACTCCTTCACTGGGGTTCCGGTCAGCCAGCAGACTTTGCTG

TTGGAGAAGGCCAGCGTTCTCTTCAACATTGGGGCGCTCTACACCCAGATCGGGACCCGCTGTAACCGGCAGACGCAGGCTGGCTTAGAGAGCGCTGTGG

ATGCCTTTCAAAGAGCTGCAG GGGTTTTAAACTACCTGAAAGAGACCTTCACTCACACTCCAAGTTACGACATGAGCCCTGCCATGCTCAGTGTGCTGG

TCAAAATGATGCTCGCCCAAGCCCAAGAAAGTGTGTTTGAGAAAGTCTGCCTCCCGGGGATCCAGAACGAGTTCTTCGTGCTGGTAAAGGTGGCTCAGGA

GGCTGCCAAG GTGGCAGAGGCCTACCGGCAGCTGCATGCGGCCATGAGCCAGGAACCAGTGAAAGAGAACATCCCGTATTCGTGGGCCAGTGTGGCCTA

TGTGAAGGCCTACCACTATGGGGCCCTGGCTCACTACTTTGCGGCCACCCTCCTCATCGACCACCAGC TAAAGCCAGGCGCAGACGAGGACCACCAAGA

GAAGTGTCTGTCCCAGCTCTATGACCGCATGCCAGAAGGGATGACGCCGCTGGCCACGCTGAAGAATGCTGGGCAGCGTGTGCTGCTGG GTAAAGGACA

TCTGCACCGGGCCATTGGTTTTCACGAGGAGTCACTGAGGGAGGCCAACCTGTGCAAGAAGCTGCGTGACATTCAGGTGCTCCGGGATGTGCTGTCTGCT

GCCCATCAGCGCACTCAGCTCAAGCACACCCAGCACCGAGAGGATGACGACCTTCTGAACCTGATTGACGCTCCAGATGTCCTTC - UNI9940 - CA

AAAACTGAGCGAGAGGTCAAAATAACCTTCCCCGACTTTTCCAAAGTGACAGTGACAGACTTCTTCCAGAAGCTG GGTCCCCTGTCTGTGTTTTCGGCC

AGCAAGAGATGGTCACCTCCTCGGGGCATTCACTTCACAGTGGAGGAAGGGGACTTGGGGTTCACCTTACGAGGGAACACCCCAGTCCAGGTACACTTCC

TGGATCCTCACTGCTCTGCTTCG CTTGCAGGGGCCAAGGAAGGAGATTACATTGTTTCCATTCAAGGCGTGGATTGCAAGTGGCTGACAGTGAGTGAGG

TTATGAAGTTGCTGAAGAGCTTTGGGGGAGAAGAGGTTGAGATGAAGGTCGTGAGCCTCCTGGACTCCACATCGTCCATG CATAATAAGTGTGCCACTT

ACTCTGTGGGGATGCAGAAAACTTACTCCATGATATGCCTGTCCATGGACGATGATGACAAAGCTGACAAAACCAAGAAGATCTCAAAAAAGCTCTCCTT

CTTGAGTTGGGGCACTAGTAAAAACAGACAGAAGTCGGCCAGCACGCTGTGCCTCCCCGAGGTTGGCCTGGCGAGGTCGCAAAACAAGAAGAAACTCCCG

ACTCCCTTCAGCCTGCTCAACTCTGACAGCTCTCTGTACTGAAGGGAGGAGCCAGAACAGGCCACACCGAGGTCGCCACAGCTGCCTAACCGCCCATGCC

GCGATGGGACTGTTCTCCAACCCCATCTTCTCAGACTGTAAACTTTGATGTGCTTGTGAACATGAAAAAGAGACCTCTAGAAATTGGTGAGAAACCCAGC

CGCATGGGGATTTTCACATTGCTGCAGTTATTTATTCTATAATGTAGGGCATAGAAGAGCCTGAATATTTTAGCTGTTTTTTTTGGTTTTCCAAGACAAT

TTTCTGTGTAGCCCTGCCTGCCTTAGAAGTTGCCCTG GTCGACATAGTGAGTTCCAGGACAGCTGGGGCTACACAGAGAAACCCTCTCTCAAACAAACA

AAACCGAAACAGGCTGCTTTAAGTACTTGGGAATTCATGAGATGAAATGACACATCTTCTGTCATCCCTGCATAATTTGACTGTTCTTTCCCAGATGAAG

TCTAGTGCCAATTTTGTCTTTCCTTCCTCCAGAATCAGCCCCCCTCAGCTATATCATACTGACCAGTAGCTAACACAGTGGCAGTGTTAGGAGATACCGT

CTACAGGGTAGATAATATGCTGTTTGATACTCAAAACGTTGCTCTTTTTGTTTAAAGTAGGAGGTATGTAACTGTGTATTTTAAGAGTCTTGGTTTAAGT

AGTAGTTTCGCAGTTTACAAGGTAAAGACGTAAACTTACTCAAGTTGAAACCTCTACTCGACTTTGTAAGATGTATCTACCAACTTGACTTTGGGGCTAT

AGGTTGGATGACACTGTGACAGAGTCACGGTTGACACAGTTCAAGTGATAAGTTTAAGGATATATAGCCTGTGGATCTTAAAGTAACAAGGATTTAAATA

TTTTTCTATTGTGCAATATCTGGAGAACACAAATGCCTTAAGGAAAGTGTGCCCGCTATCCCTGGGGCTCTGTTTGTATAAATATTTAAATAAAGTCATG

TTCATTGTTTG
Translation
MTDTLLPAAPQPLEKEGDDYFRK - UNI31609 - GCNPLAQTGRSKLQNQRAALNQQILKAVRMRTGAENLLK - UNI20200 - KVATNQKVRE

QVRLELSFVNSDLQMLKEELEGLNISVGVYQGTE EEAFTIPLIPLGLKETKEVDFSIVFK DFILEHYSEDSYLYEDDIADLMDLRQ ACRTPSRDEAG

VELLMSYFIQLGFVESRFFPPTRHMGLLFTW WYDSFTGVPVSQQTLLLEKASVLFNIGALYTQIGTRCNRQTQAGLESAVDAFQRAAG GVLNYLKETF

THTPSYDMSPAMLSVLVKMMLAQAQESVFEKVCLPGIQNEFFVLVKVAQEAAK VAEAYRQLHAAMSQEPVKENIPYSWASVAYVKAYHYGALAHYFAAT

LLIDHQL LKPGADEDHQEKCLSQLYDRMPEGMTPLATLKNAGQRVLLG GKGHLHRAIGFHEESLREANLCKKLRDIQVLRDVLSAAHQRTQLKHTQHR

EDDDLLNLIDAPDVLP - UNI9940 - PKTEREVKITFPDFSKVTVTDFFQKL GPLSVFSASKRWSPPRGIHFTVEEGDLGFTLRGNTPVQVHFLDP

HCSAS LAGAKEGDYIVSIQGVDCKWLTVSEVMKLLKSFGGEEVEMKVVSLLDSTSSM HNKCATYSVGMQKTYSMICLSMDDDDKADKTKKISKKLSFL

SWGTSKNRQKSASTLCLPEVGLARSQNKKKLPTPFSLLNSDSSLY 

For any suggestions or comments, please send an email to unitrap@crg.es